FACIAL

Cosmética facial 

Cuida tu piel con nuestra dermocosmética facial

Mostrando 1-36 de 179 artículo(s)
Producto añadido
Producto añadido a Comparar

Este sitio web utiliza cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Para dar su consentimiento sobre su uso pulse el botón Acepto.

Load Time 926 ms
Querying Time 325 ms
Queries 734
Memory Peak Usage 64.7 Mb
Included Files 1226 files - 12.67 Mb
PrestaShop Cache - Mb
Global vars 0.05 Mb
PrestaShop Version 8.2.7
PHP Version 8.4.10
MySQL Version 8.0.45-36
Memory Limit 512M
Max Execution Time 165s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 136.679 ms 136.679 ms 18.40 Mb 19.6 Mb
__construct 0.045 ms 136.724 ms - Mb 19.6 Mb
init 57.305 ms 194.029 ms 5.29 Mb 24.7 Mb
checkAccess 0.003 ms 194.032 ms - Mb 24.7 Mb
setMedia 5.573 ms 199.605 ms 0.79 Mb 24.7 Mb
postProcess 0.001 ms 199.606 ms - Mb 24.7 Mb
initHeader 0.002 ms 199.608 ms - Mb 24.7 Mb
initContent 502.393 ms 702.001 ms 23.76 Mb 48.3 Mb
initFooter 0.002 ms 702.003 ms - Mb 48.3 Mb
display 224.045 ms 926 ms 15.31 Mb 64.7 Mb
Hook Time Memory Usage
DisplayProductCampagains 101.182 ms 6.55 Mb
displayProductListReviews 21.615 ms 1.40 Mb
displayProductListFunctionalButtons 12.128 ms 0.09 Mb
DisplayBeforeBodyClosingTag 7.535 ms 0.32 Mb
displayBeforeBodyClosingTag 6.073 ms 0.81 Mb
displayLeftColumn 4.085 ms 0.23 Mb
DisplayHeader 3.751 ms 0.18 Mb
renderWidget 3.274 ms 0.18 Mb
displayNav2 2.937 ms 0.18 Mb
displayFooter 2.386 ms 0.10 Mb
ProductSearchProvider 1.928 ms 0.20 Mb
displayNav1 1.873 ms 0.21 Mb
displayMainMenu 1.853 ms 0.20 Mb
displayCategoryElementor 1.342 ms 0.08 Mb
displayTop 1.177 ms 0.12 Mb
ActionFrontControllerSetMedia 1.106 ms 0.13 Mb
displayCustomerLoginFormAfter 1.050 ms 0.07 Mb
displayAfterBreadcrumb 0.665 ms 0.04 Mb
IsJustElementor 0.442 ms 0.02 Mb
DisplayLeftColumn 0.194 ms 0.06 Mb
OverrideLayoutTemplate 0.083 ms - Mb
ModuleRoutes 0.011 ms - Mb
ActionDispatcher 0.009 ms - Mb
displayVerticalMenu 0.007 ms - Mb
ActionProductSearchAfter 0.006 ms - Mb
25 hook(s) 176.711 ms 11.17 Mb
Module Time Memory Usage
ph_simpleblog 19.719 ms 3.30 Mb
iqitthemeeditor 2.963 ms 0.54 Mb
ps_emailsubscription 2.908 ms 0.37 Mb
ps_emailalerts 1.641 ms 0.29 Mb
iqitproductvariants 0.420 ms 0.04 Mb
revsliderprestashop 46.555 ms 7.98 Mb
productcomments 1.348 ms 0.28 Mb
ps_shoppingcart 1.504 ms 0.17 Mb
iqitcontactpage 1.574 ms 0.12 Mb
iqitcookielaw 1.427 ms 0.11 Mb
iqitcountdown 0.261 ms 0.03 Mb
iqitsociallogin 1.645 ms 0.14 Mb
ps_googleanalytics 5.529 ms 0.36 Mb
iqitsizecharts 1.489 ms 0.26 Mb
iqitwishlist 12.677 ms 0.95 Mb
iqitreviews 22.300 ms 1.51 Mb
iqitpopup 1.465 ms 0.15 Mb
iqitmegamenu 7.556 ms 1.06 Mb
iqitcompare 6.932 ms 0.17 Mb
iqitelementor 8.313 ms 1.07 Mb
iqitextendedproduct 1.333 ms 0.16 Mb
iqitfreedeliverycount 0.496 ms 0.06 Mb
ps_facetedsearch 6.806 ms 0.87 Mb
iqitlinksmanager 4.128 ms 0.38 Mb
ps_languageselector 0.839 ms 0.07 Mb
ps_currencyselector 0.873 ms 0.07 Mb
iqitsearch 2.637 ms 0.12 Mb
ps_customersignin 0.160 ms 0.03 Mb
iqitproductsnav 0.976 ms 0.07 Mb
iqitproductflags 101.756 ms 6.68 Mb
ps_categorytree 4.504 ms 0.29 Mb
statsdata 4.017 ms 0.17 Mb
32 module(s) 276.751 ms 27.87 Mb

Stopwatch SQL - 734 queries

# Query Time (ms) Rows Filesort Group By Location
75
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=3 AND c.nleft>7 AND c.nright<40 GROUP BY cp.id_category
26.040 ms 502900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `och438configuration` c
LEFT JOIN `och438configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
7.320 ms 1327 /classes/Configuration.php:180
72
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
3.059 ms 1620 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `och438module` m
INNER JOIN och438module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `och438hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `och438hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `och438module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.005 ms 1560 Yes Yes /classes/Hook.php:1289
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `och438hook` h
WHERE (h.active = 1)
2.560 ms 1143 /classes/Hook.php:1388
83
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p GROUP BY p.id_manufacturer
2.466 ms 810 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
731
INSERT INTO `och438connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('199964', '', 'farmacialanueva.online/22-facial?q=Categor%C3%ADas-LIMPIADORES-LOVREN+COSMETICA-CREMAS&resultsPerPage=36', '', '2026-06-22 20:10:51')
2.248 ms 1 /classes/ObjectModel.php:622
91
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p LEFT JOIN och438specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 6) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-06-22 20:10:51' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-06-22 20:10:51' <= sp.to) 
) WHERE ((sp.reduction>0))
1.951 ms 810 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook`
1.881 ms 1143 /classes/Hook.php:1348
90
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p WHERE p.date_add>'2026-06-03 00:00:00'
1.642 ms 810 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
733
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `och438category_product` cp
LEFT JOIN `och438category` c ON (c.id_category = cp.id_category)
LEFT JOIN `och438category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (2381,743,678,2382,2383,689,2384,747,690,2385,749,693,2386,752,694,2387,2388,755,2389,1209,2390,1189,2391,1294,761,2392,1364,762,2393,1270,2394,1378,2395,1438,2396,756) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
1.635 ms 2745 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:103
89
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p WHERE ((p.on_sale=1))
1.562 ms 810 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
92
REPLACE INTO och438layered_filter_block (hash, data) VALUES ("49ff6a640c936f7722f068f24b4d15a7", "a:1:{s:7:\"filters\";a:4:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:16:{i:26;a:3:{s:4:\"name\";s:11:\"LIMPIADORES\";s:3:\"nbr\";s:2:\"63\";s:7:\"checked\";b:1;}i:29;a:2:{s:4:\"name\";s:5:\"SERUM\";s:3:\"nbr\";s:3:\"113\";}i:33;a:2:{s:4:\"name\";s:16:\"CONTORNO DE OJOS\";s:3:\"nbr\";s:2:\"35\";}i:40;a:2:{s:4:\"name\";s:11:\"EXFOLIANTES\";s:3:\"nbr\";s:2:\"16\";}i:41;a:2:{s:4:\"name\";s:11:\"MASCARILLAS\";s:3:\"nbr\";s:2:\"51\";}i:42;a:2:{s:4:\"name\";s:8:\"TÓNICOS\";s:3:\"nbr\";s:2:\"23\";}i:43;a:2:{s:4:\"name\";s:8:\"AMPOLLAS\";s:3:\"nbr\";s:2:\"11\";}i:44;a:3:{s:4:\"name\";s:6:\"CREMAS\";s:3:\"nbr\";s:2:\"93\";s:7:\"checked\";b:1;}i:45;a:2:{s:4:\"name\";s:8:\"ESENCIAS\";s:3:\"nbr\";s:2:\"11\";}i:94;a:2:{s:4:\"name\";s:11:\"MAQUILLAJES\";s:3:\"nbr\";s:3:\"106\";}i:130;a:2:{s:4:\"name\";s:17:\"COSMETICA COREANA\";s:3:\"nbr\";s:3:\"150\";}i:131;a:2:{s:4:\"name\";s:16:\"POTENCIA TU GLOW\";s:3:\"nbr\";s:3:\"105\";}i:138;a:2:{s:4:\"name\";s:7:\"MANCHAS\";s:3:\"nbr\";s:2:\"13\";}i:272;a:3:{s:4:\"name\";s:16:\"LOVREN COSMETICA\";s:3:\"nbr\";s:2:\"24\";s:7:\"checked\";b:1;}i:274;a:2:{s:4:\"name\";s:8:\"ERBORIAN\";s:3:\"nbr\";s:2:\"76\";}i:275;a:2:{s:4:\"name\";s:12:\"DESODORANTES\";s:3:\"nbr\";s:1:\"6\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:19:{i:5;a:2:{s:4:\"name\";s:14:\"Cantabria Labs\";s:3:\"nbr\";s:1:\"1\";}i:6;a:2:{s:4:\"name\";s:6:\"Cerave\";s:3:\"nbr\";s:2:\"12\";}i:7;a:2:{s:4:\"name\";s:3:\"SVR\";s:3:\"nbr\";s:1:\"1\";}i:11;a:2:{s:4:\"name\";s:14:\"LA ROCHE POSAY\";s:3:\"nbr\";s:2:\"10\";}i:12;a:2:{s:4:\"name\";s:11:\"IFCANTABRIA\";s:3:\"nbr\";s:2:\"16\";}i:13;a:2:{s:4:\"name\";s:15:\"LAB SVR ESPAÑA\";s:3:\"nbr\";s:2:\"37\";}i:14;a:2:{s:4:\"name\";s:13:\"SKINCEUTICALS\";s:3:\"nbr\";s:1:\"9\";}i:57;a:2:{s:4:\"name\";s:11:\"ARTURO ALBA\";s:3:\"nbr\";s:1:\"8\";}i:58;a:2:{s:4:\"name\";s:8:\"ERBORIAN\";s:3:\"nbr\";s:1:\"3\";}i:61;a:2:{s:4:\"name\";s:3:\"TWO\";s:3:\"nbr\";s:1:\"8\";}i:67;a:2:{s:4:\"name\";s:22:\"L´occitane (erborian)\";s:3:\"nbr\";s:1:\"8\";}i:68;a:2:{s:4:\"name\";s:18:\"GEMA HERRERIA S.LU\";s:3:\"nbr\";s:2:\"12\";}i:70;a:2:{s:4:\"name\";s:19:\"MIIN COSMETICS S.L.\";s:3:\"nbr\";s:1:\"2\";}i:87;a:2:{s:4:\"name\";s:7:\"OZOAQUA\";s:3:\"nbr\";s:1:\"1\";}i:93;a:2:{s:4:\"name\";s:16:\"BEAUTY OF JOSEON\";s:3:\"nbr\";s:1:\"5\";}i:94;a:2:{s:4:\"name\";s:6:\"TOCOBO\";s:3:\"nbr\";s:1:\"3\";}i:100;a:2:{s:4:\"name\";s:12:\"CANTABRIA PH\";s:3:\"nbr\";s:1:\"2\";}i:112;a:2:{s:4:\"name\";s:6:\"d\'Alba\";s:3:\"nbr\";s:1:\"2\";}i:115;a:2:{s:4:\"name\";s:8:\"MEDICUBE\";s:3:\"nbr\";s:1:\"5\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:234;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:179;s:5:\"value\";N;}i:3;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Selecciones\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:9:\"En oferta\";s:3:\"nbr\";i:5;}s:3:\"new\";a:2:{s:4:\"name\";s:5:\"Nuevo\";s:3:\"nbr\";i:2;}s:8:\"discount\";a:2:{s:4:\"name\";s:13:\"Con descuento\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
1.477 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:210
101
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `och438hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `och438hook_alias` ha
INNER JOIN `och438hook` h ON ha.name = h.name
1.441 ms 0 /classes/Hook.php:1348
68
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'LOVREN COSMETICA'
AND c.`id_category` != 2
AND c.`id_parent` = 22 LIMIT 1
1.434 ms 2 /classes/Category.php:1492
102
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `och438hook_module` hm
STRAIGHT_JOIN `och438hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `och438module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
1.397 ms 524 /classes/Hook.php:455
37
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `och438category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 22
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.199 ms 61 Yes Yes /classes/Category.php:916
93
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-06-22 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM och438product p
LEFT JOIN och438product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN och438stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN och438product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (2381,743,678,2382,2383,689,2384,747,690,2385,749,693,2386,752,694,2387,2388,755,2389,1209,2390,1189,2391,1294,761,2392,1364,762,2393,1270,2394,1378,2395,1438,2396,756)
1.155 ms 36 /classes/ProductAssembler.php:95
84
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM och438product p INNER JOIN och438layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 6) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44)
1.050 ms 135 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
74
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.974 ms 61 Yes /classes/Category.php:710
82
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.950 ms 129 Yes /classes/Manufacturer.php:201
69
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'CREMAS'
AND c.`id_category` != 2
AND c.`id_parent` = 22 LIMIT 1
0.936 ms 2 /classes/Category.php:1492
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `och438meta` m
LEFT JOIN `och438meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.918 ms 57 Yes /classes/Dispatcher.php:654
22
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.884 ms 104 /classes/module/Module.php:341
77
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute
0.868 ms 270 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
79
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute
0.862 ms 270 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.859 ms 104 /classes/module/Module.php:341
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM och438shop_url su
LEFT JOIN och438shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'farmacialanueva.online' OR su.domain_ssl = 'farmacialanueva.online')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.857 ms 1 Yes /classes/shop/Shop.php:1364
716
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `och438category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `och438category` c2 ON c2.`id_category` = 22 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 6 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
0.814 ms 61 Yes Yes /classes/Category.php:785
76
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC
0.791 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
572
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 756) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM och438shop_group gs
LEFT JOIN och438shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN och438shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.772 ms 1 Yes /classes/shop/Shop.php:715
80
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value
0.763 ms 270 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
531
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1189) AND (b.`id_shop` = 1) LIMIT 1
0.754 ms 1 /src/Adapter/EntityMapper.php:71
88
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute
0.742 ms 270 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
23
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) AND (b.`id_shop` = 1) LIMIT 1
0.736 ms 1 /src/Adapter/EntityMapper.php:71
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `och438lang` l
JOIN och438lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.724 ms 1 /classes/Language.php:1214
54
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.709 ms 0 /classes/module/Module.php:2664
63
SELECT SQL_NO_CACHE * FROM och438revslider_sliders
0.704 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
21
SELECT SQL_NO_CACHE * FROM `och438hook_module_exceptions`
WHERE `id_shop` IN (1)
0.698 ms 1 /classes/module/Module.php:2046
81
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value
0.696 ms 270 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
78
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC
0.690 ms 14 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
537
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1294) AND (b.`id_shop` = 1) LIMIT 1
0.686 ms 1 /src/Adapter/EntityMapper.php:71
32
SELECT SQL_NO_CACHE *
FROM `och438group` a
LEFT JOIN `och438group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.661 ms 1 /src/Adapter/EntityMapper.php:71
35
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.647 ms 1 /classes/Category.php:2446
17
SELECT SQL_NO_CACHE value FROM `och438configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.644 ms 1 /classes/shop/Shop.php:1183
561
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1378) AND (b.`id_shop` = 1) LIMIT 1
0.634 ms 1 /src/Adapter/EntityMapper.php:71
121
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 743 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.631 ms 1 Yes /classes/SpecificPrice.php:576
19
SELECT SQL_NO_CACHE name, alias FROM `och438hook_alias`
0.619 ms 88 /classes/Hook.php:342
293
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2389 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2389 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.617 ms 0 /classes/Cart.php:1430
24
SELECT SQL_NO_CACHE * FROM `och438currency` c ORDER BY `iso_code` ASC
0.608 ms 1 Yes /classes/Currency.php:708
86
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (26, 272, 44) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute
0.608 ms 270 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `och438lang` l
LEFT JOIN `och438lang_shop` ls ON (l.id_lang = ls.id_lang)
0.599 ms 1 /classes/Language.php:1080
62
SELECT SQL_NO_CACHE *
FROM `och438category` a0
LEFT JOIN `och438category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 7) AND (a0.`nright` > 40) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.591 ms 4 /classes/PrestaShopCollection.php:383
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM och438shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.586 ms 1 /classes/shop/ShopUrl.php:178
29
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.582 ms 1 /src/Adapter/EntityMapper.php:71
64
SELECT SQL_NO_CACHE `name`
FROM `och438hook`
WHERE `id_hook` = 746 LIMIT 1
0.578 ms 1 /classes/Hook.php:244
38
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 26) AND (b.`id_shop` = 1) LIMIT 1
0.574 ms 1 /src/Adapter/EntityMapper.php:71
39
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 29) AND (b.`id_shop` = 1) LIMIT 1
0.572 ms 1 /src/Adapter/EntityMapper.php:71
0
SELECT SQL_NO_CACHE * FROM och438memcached_servers
0.569 ms 1 /classes/cache/CacheMemcached.php:263
4
SELECT SQL_NO_CACHE *
FROM `och438shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.566 ms 1 /src/Adapter/EntityMapper.php:71
46
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) AND (b.`id_shop` = 1) LIMIT 1
0.563 ms 1 /src/Adapter/EntityMapper.php:71
605
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2381) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.563 ms 1 Yes Yes /classes/Product.php:4513
9
SELECT SQL_NO_CACHE *
FROM `och438lang` a
LEFT JOIN `och438lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.562 ms 1 /src/Adapter/EntityMapper.php:71
546
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1364) AND (b.`id_shop` = 1) LIMIT 1
0.561 ms 1 /src/Adapter/EntityMapper.php:71
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM och438shop s
LEFT JOIN och438shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.558 ms 1 /classes/shop/Shop.php:214
26
SELECT SQL_NO_CACHE c.id_currency
FROM `och438currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.553 ms 1 /classes/Currency.php:893
10
SELECT SQL_NO_CACHE id_shop
FROM `och438lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.552 ms 1 /classes/ObjectModel.php:1727
27
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.552 ms 1 /src/Adapter/EntityMapper.php:71
33
SELECT SQL_NO_CACHE *
FROM `och438group_lang`
WHERE `id_group` = 1
0.549 ms 1 /src/Adapter/EntityMapper.php:79
70
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `och438attribute_group` ag  INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `och438layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
0.548 ms 4 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122
7
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.547 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1438
ORDER BY `position`
0.543 ms 1 Yes /classes/Product.php:3539
42
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 41) AND (b.`id_shop` = 1) LIMIT 1
0.539 ms 1 /src/Adapter/EntityMapper.php:71
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `och438hook_alias`
0.537 ms 88 /classes/Hook.php:290
31
SELECT SQL_NO_CACHE id_shop
FROM `och438currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.535 ms 1 /classes/ObjectModel.php:1727
66
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM och438layered_category
WHERE controller = 'category'
AND id_category = 22
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.534 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
25
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.530 ms 1 /classes/Language.php:880
56
SELECT SQL_NO_CACHE * FROM `och438image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.526 ms 8 Yes /classes/ImageType.php:109
43
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) AND (b.`id_shop` = 1) LIMIT 1
0.526 ms 1 /src/Adapter/EntityMapper.php:71
34
SELECT SQL_NO_CACHE id_shop
FROM `och438group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.521 ms 1 /classes/ObjectModel.php:1727
44
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 43) AND (b.`id_shop` = 1) LIMIT 1
0.521 ms 1 /src/Adapter/EntityMapper.php:71
71
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `och438feature` f  INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `och438feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `och438layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.521 ms 6 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:159
41
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.519 ms 1 /src/Adapter/EntityMapper.php:71
40
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.518 ms 1 /src/Adapter/EntityMapper.php:71
45
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
0.513 ms 1 /src/Adapter/EntityMapper.php:71
55
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.512 ms 0 /classes/module/Module.php:2137
85
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC
0.510 ms 3 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
30
SELECT SQL_NO_CACHE *
FROM `och438currency_lang`
WHERE `id_currency` = 1
0.510 ms 1 /src/Adapter/EntityMapper.php:79
53
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 275) AND (b.`id_shop` = 1) LIMIT 1
0.510 ms 1 /src/Adapter/EntityMapper.php:71
371
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1364 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.508 ms 1 Yes /classes/SpecificPrice.php:576
8
SELECT SQL_NO_CACHE *
FROM `och438shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.507 ms 1 /src/Adapter/EntityMapper.php:71
28
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.503 ms 1 /classes/Language.php:880
376
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1364 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1364 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.503 ms 0 /classes/Cart.php:1430
552
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2393) AND (b.`id_shop` = 1) LIMIT 1
0.492 ms 1 /src/Adapter/EntityMapper.php:71
51
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 272) AND (b.`id_shop` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
67
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 )
WHERE `name` = 'LIMPIADORES'
AND c.`id_category` != 2
AND c.`id_parent` = 22 LIMIT 1
0.486 ms 2 /classes/Category.php:1492
653
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2388) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.486 ms 1 Yes Yes /classes/Product.php:4513
443
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1438 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.485 ms 1 Yes /classes/SpecificPrice.php:576
59
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.484 ms 1 /src/Adapter/EntityMapper.php:71
662
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1209) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.483 ms 1 Yes Yes /classes/Product.php:4513
48
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1
0.483 ms 1 /src/Adapter/EntityMapper.php:71
211
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 749 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.481 ms 1 Yes /classes/SpecificPrice.php:576
36
SELECT SQL_NO_CACHE ctg.`id_group`
FROM och438category_group ctg
WHERE ctg.`id_category` = 22 AND ctg.`id_group` = 1 LIMIT 1
0.480 ms 1 /classes/Category.php:1751
180
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 747 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.478 ms 1 Yes /classes/SpecificPrice.php:576
110
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2381 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2381 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.477 ms 0 /classes/Cart.php:1430
638
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.475 ms 1 Yes Yes /classes/Product.php:4513
279
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 755 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.474 ms 1 Yes /classes/SpecificPrice.php:576
250
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 694 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.473 ms 1 Yes /classes/SpecificPrice.php:576
677
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (761) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.473 ms 1 Yes Yes /classes/Product.php:4513
678
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2392
0.472 ms 2 /classes/Product.php:3420
644
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (752) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.472 ms 1 Yes Yes /classes/Product.php:4513
60
SELECT SQL_NO_CACHE *
FROM `och438country_lang`
WHERE `id_country` = 6
0.471 ms 1 /src/Adapter/EntityMapper.php:79
689
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2393) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.469 ms 1 Yes Yes /classes/Product.php:4513
234
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2386 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2386 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.468 ms 0 /classes/Cart.php:1430
665
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2390) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.468 ms 1 Yes Yes /classes/Product.php:4513
99
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2381)
0.466 ms 1 /classes/Product.php:3860
647
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (694) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.466 ms 1 Yes Yes /classes/Product.php:4513
516
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2388) AND (b.`id_shop` = 1) LIMIT 1
0.465 ms 1 /src/Adapter/EntityMapper.php:71
668
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1189) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.465 ms 1 Yes Yes /classes/Product.php:4513
50
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 138) AND (b.`id_shop` = 1) LIMIT 1
0.465 ms 1 /src/Adapter/EntityMapper.php:71
52
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 274) AND (b.`id_shop` = 1) LIMIT 1
0.464 ms 1 /src/Adapter/EntityMapper.php:71
466
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 756 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 756 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.464 ms 0 /classes/Cart.php:1430
659
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2389) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.464 ms 1 Yes Yes /classes/Product.php:4513
683
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1364) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.464 ms 1 Yes Yes /classes/Product.php:4513
641
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2386) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.463 ms 1 Yes Yes /classes/Product.php:4513
635
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (749) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.462 ms 1 Yes Yes /classes/Product.php:4513
674
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1294) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.462 ms 1 Yes Yes /classes/Product.php:4513
707
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2396) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.462 ms 1 Yes Yes /classes/Product.php:4513
49
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1
0.462 ms 1 /src/Adapter/EntityMapper.php:71
629
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (690) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.460 ms 1 Yes Yes /classes/Product.php:4513
87
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC
0.459 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
620
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (689) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4513
274
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2388
ORDER BY f.position ASC
0.458 ms 1 Yes /classes/Product.php:6024
617
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2383) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.457 ms 1 Yes Yes /classes/Product.php:4513
177
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 12
AND `active` = 1 LIMIT 1
0.456 ms 1 /classes/Manufacturer.php:312
632
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2385) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.455 ms 1 Yes Yes /classes/Product.php:4513
704
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1438) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.455 ms 1 Yes Yes /classes/Product.php:4513
47
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 94) AND (b.`id_shop` = 1) LIMIT 1
0.454 ms 1 /src/Adapter/EntityMapper.php:71
136
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 678 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 678 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.454 ms 0 /classes/Cart.php:1430
656
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (755) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.454 ms 1 Yes Yes /classes/Product.php:4513
351
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 761 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.454 ms 1 Yes /classes/SpecificPrice.php:576
650
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2387) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.454 ms 1 Yes Yes /classes/Product.php:4513
626
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (747) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.453 ms 1 Yes Yes /classes/Product.php:4513
686
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (762) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.452 ms 1 Yes Yes /classes/Product.php:4513
608
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (743) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.452 ms 1 Yes Yes /classes/Product.php:4513
701
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2395) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.451 ms 1 Yes Yes /classes/Product.php:4513
680
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2392) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.449 ms 1 Yes Yes /classes/Product.php:4513
698
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1378) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.448 ms 1 Yes Yes /classes/Product.php:4513
243
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 752 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 752 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.447 ms 0 /classes/Cart.php:1430
623
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2384) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.447 ms 1 Yes Yes /classes/Product.php:4513
145
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2382 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2382 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.446 ms 0 /classes/Cart.php:1430
695
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2394) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.446 ms 1 Yes Yes /classes/Product.php:4513
284
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 755 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 755 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.444 ms 0 /classes/Cart.php:1430
692
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1270) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.444 ms 1 Yes Yes /classes/Product.php:4513
300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1209 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.443 ms 1 Yes /classes/SpecificPrice.php:576
569
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2396) AND (b.`id_shop` = 1) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
611
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (678) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.443 ms 1 Yes Yes /classes/Product.php:4513
671
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2391) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.443 ms 1 Yes Yes /classes/Product.php:4513
614
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2382) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.442 ms 1 Yes Yes /classes/Product.php:4513
402
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1270 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.441 ms 1 Yes /classes/SpecificPrice.php:576
710
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (756) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.439 ms 1 Yes Yes /classes/Product.php:4513
365
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2392 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2392 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.438 ms 0 /classes/Cart.php:1430
204
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2385 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2385 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.437 ms 0 /classes/Cart.php:1430
555
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1270) AND (b.`id_shop` = 1) LIMIT 1
0.437 ms 1 /src/Adapter/EntityMapper.php:71
216
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 749 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 749 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.436 ms 0 /classes/Cart.php:1430
320
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1189 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.436 ms 1 Yes /classes/SpecificPrice.php:576
57
SELECT SQL_NO_CACHE format
FROM `och438address_format`
WHERE `id_country` = 6 LIMIT 1
0.436 ms 1 /classes/AddressFormat.php:653
522
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2389) AND (b.`id_shop` = 1) LIMIT 1
0.436 ms 1 /src/Adapter/EntityMapper.php:71
163
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 689 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 689 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.434 ms 0 /classes/Cart.php:1430
540
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 761) AND (b.`id_shop` = 1) LIMIT 1
0.434 ms 1 /src/Adapter/EntityMapper.php:71
225
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.433 ms 0 /classes/Cart.php:1430
117
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `och438specific_price` WHERE `id_product` != 0
0.429 ms 521 /classes/SpecificPrice.php:310
407
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1270 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1270 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.427 ms 0 /classes/Cart.php:1430
538
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1294
ORDER BY `position`
0.426 ms 1 Yes /classes/Product.php:3539
573
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 756
ORDER BY `position`
0.426 ms 2 Yes /classes/Product.php:3539
208
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 749) AND (b.`id_shop` = 1) LIMIT 1
0.426 ms 1 /src/Adapter/EntityMapper.php:71
340
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1294 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.425 ms 1 Yes /classes/SpecificPrice.php:576
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 690 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 690 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
382
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 762 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.423 ms 1 Yes /classes/SpecificPrice.php:576
549
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 762) AND (b.`id_shop` = 1) LIMIT 1
0.423 ms 1 /src/Adapter/EntityMapper.php:71
564
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2395) AND (b.`id_shop` = 1) LIMIT 1
0.422 ms 1 /src/Adapter/EntityMapper.php:71
264
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2387 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2387 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.421 ms 0 /classes/Cart.php:1430
510
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 694) AND (b.`id_shop` = 1) LIMIT 1
0.420 ms 1 /src/Adapter/EntityMapper.php:71
468
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2381) AND (b.`id_shop` = 1) LIMIT 1
0.419 ms 1 /src/Adapter/EntityMapper.php:71
255
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 694 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 694 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.418 ms 0 /classes/Cart.php:1430
476
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 678) AND (b.`id_shop` = 1) LIMIT 1
0.417 ms 1 /src/Adapter/EntityMapper.php:71
504
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2386) AND (b.`id_shop` = 1) LIMIT 1
0.417 ms 1 /src/Adapter/EntityMapper.php:71
507
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 752) AND (b.`id_shop` = 1) LIMIT 1
0.416 ms 1 /src/Adapter/EntityMapper.php:71
273
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2388 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2388 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.415 ms 0 /classes/Cart.php:1430
730
SELECT SQL_NO_CACHE `id_guest`
FROM `och438connections`
WHERE `id_guest` = 200399
AND `date_add` > '2026-06-22 19:40:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.415 ms 1 Yes /classes/Connection.php:168
126
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 743 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 743 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.415 ms 0 /classes/Cart.php:1430
467
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 756
ORDER BY f.position ASC
0.415 ms 1 Yes /classes/Product.php:6024
61
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM och438required_field
0.414 ms 1 /classes/ObjectModel.php:1592
185
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 747 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 747 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.412 ms 0 /classes/Cart.php:1430
525
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1209) AND (b.`id_shop` = 1) LIMIT 1
0.411 ms 1 /src/Adapter/EntityMapper.php:71
154
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2383 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2383 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.411 ms 0 /classes/Cart.php:1430
73
SELECT SQL_NO_CACHE data FROM och438layered_filter_block WHERE hash="49ff6a640c936f7722f068f24b4d15a7" LIMIT 1
0.410 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
439
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1438) AND (b.`id_shop` = 1) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
637
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 693 LIMIT 1
0.409 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
541
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 761
ORDER BY `position`
0.408 ms 1 Yes /classes/Product.php:3539
325
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1189 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1189 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.407 ms 0 /classes/Cart.php:1430
577
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.407 ms 13 /classes/CartRule.php:357
176
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 747) AND (b.`id_shop` = 1) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1209 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1209 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.406 ms 0 /classes/Cart.php:1430
457
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2396 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2396 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.406 ms 0 /classes/Cart.php:1430
721
SELECT SQL_NO_CACHE c.*, cl.*  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 121 ORDER BY `nleft` DESC
0.406 ms 4 /classes/Category.php:1594
532
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1189
ORDER BY `position`
0.405 ms 1 Yes /classes/Product.php:3539
640
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2386 LIMIT 1
0.404 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
387
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 762 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 762 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.403 ms 0 /classes/Cart.php:1430
732
SELECT SQL_NO_CACHE data
FROM `och438ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.403 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:39
356
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 761 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 761 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.403 ms 0 /classes/Cart.php:1430
396
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2393 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2393 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.402 ms 0 /classes/Cart.php:1430
448
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1438 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1438 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.402 ms 0 /classes/Cart.php:1430
676
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 761 LIMIT 1
0.402 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
172
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2384 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2384 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.401 ms 0 /classes/Cart.php:1430
397
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2393
ORDER BY f.position ASC
0.401 ms 1 Yes /classes/Product.php:6024
235
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2386
ORDER BY f.position ASC
0.400 ms 1 Yes /classes/Product.php:6024
435
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2395 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2395 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.398 ms 0 /classes/Cart.php:1430
314
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2390 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2390 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.398 ms 0 /classes/Cart.php:1430
416
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2394 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2394 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.398 ms 0 /classes/Cart.php:1430
543
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2392) AND (b.`id_shop` = 1) LIMIT 1
0.398 ms 1 /src/Adapter/EntityMapper.php:71
200
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2385)
0.397 ms 1 /classes/Product.php:3860
602
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitreviews" LIMIT 1
0.397 ms 1 /classes/module/Module.php:2664
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 690
ORDER BY f.position ASC
0.395 ms 1 Yes /classes/Product.php:6024
479
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2382) AND (b.`id_shop` = 1) LIMIT 1
0.394 ms 1 /src/Adapter/EntityMapper.php:71
377
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1364
ORDER BY f.position ASC
0.393 ms 1 Yes /classes/Product.php:6024
426
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1378 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1378 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.393 ms 0 /classes/Cart.php:1430
667
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1189 LIMIT 1
0.393 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
482
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2383) AND (b.`id_shop` = 1) LIMIT 1
0.392 ms 1 /src/Adapter/EntityMapper.php:71
578
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.392 ms 13 /classes/CartRule.php:357
408
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1270
ORDER BY f.position ASC
0.391 ms 1 Yes /classes/Product.php:6024
473
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 743) AND (b.`id_shop` = 1) LIMIT 1
0.391 ms 1 /src/Adapter/EntityMapper.php:71
519
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 755) AND (b.`id_shop` = 1) LIMIT 1
0.391 ms 1 /src/Adapter/EntityMapper.php:71
558
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2394) AND (b.`id_shop` = 1) LIMIT 1
0.390 ms 1 /src/Adapter/EntityMapper.php:71
345
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1294 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1294 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.389 ms 0 /classes/Cart.php:1430
501
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 693) AND (b.`id_shop` = 1) LIMIT 1
0.389 ms 1 /src/Adapter/EntityMapper.php:71
652
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2388 LIMIT 1
0.389 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
58
SELECT SQL_NO_CACHE `need_identification_number`
FROM `och438country`
WHERE `id_country` = 6 LIMIT 1
0.386 ms 1 /classes/Country.php:402
334
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2391 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2391 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.386 ms 0 /classes/Cart.php:1430
469
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2381
ORDER BY `position`
0.385 ms 1 Yes /classes/Product.php:3539
646
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 694 LIMIT 1
0.385 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
718
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
137
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 678
ORDER BY f.position ASC
0.385 ms 1 Yes /classes/Product.php:6024
485
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 689) AND (b.`id_shop` = 1) LIMIT 1
0.384 ms 1 /src/Adapter/EntityMapper.php:71
576
SELECT SQL_NO_CACHE 1 FROM och438cart_product cp INNER JOIN och438product p
ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.384 ms 1 /classes/Cart.php:4250
513
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2387) AND (b.`id_shop` = 1) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
499
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 749
ORDER BY `position`
0.382 ms 1 Yes /classes/Product.php:3539
625
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 747 LIMIT 1
0.382 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
534
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2391) AND (b.`id_shop` = 1) LIMIT 1
0.381 ms 1 /src/Adapter/EntityMapper.php:71
562
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1378
ORDER BY `position`
0.381 ms 1 Yes /classes/Product.php:3539
634
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 749 LIMIT 1
0.380 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
111
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2381
ORDER BY f.position ASC
0.379 ms 1 Yes /classes/Product.php:6024
664
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2390 LIMIT 1
0.378 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
675
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 761
0.377 ms 2 /classes/Product.php:3420
116
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `id_product` != 0 LIMIT 1
0.375 ms 521 /classes/SpecificPrice.php:297
265
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2387
ORDER BY f.position ASC
0.375 ms 1 Yes /classes/Product.php:6024
205
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2385
ORDER BY f.position ASC
0.373 ms 1 Yes /classes/Product.php:6024
633
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 749
0.373 ms 2 /classes/Product.php:3420
651
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2388
0.373 ms 2 /classes/Product.php:3420
493
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 690) AND (b.`id_shop` = 1) LIMIT 1
0.373 ms 1 /src/Adapter/EntityMapper.php:71
643
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 752 LIMIT 1
0.373 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
658
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2389 LIMIT 1
0.373 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
207
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.372 ms 1 /classes/Product.php:5670
694
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2394 LIMIT 1
0.372 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
103
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.371 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:100
186
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 747
ORDER BY f.position ASC
0.370 ms 1 Yes /classes/Product.php:6024
496
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2385) AND (b.`id_shop` = 1) LIMIT 1
0.370 ms 1 /src/Adapter/EntityMapper.php:71
666
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1189
0.370 ms 2 /classes/Product.php:3420
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 690)
0.369 ms 1 /classes/Product.php:3860
217
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 749
ORDER BY f.position ASC
0.368 ms 1 Yes /classes/Product.php:6024
547
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1364
ORDER BY `position`
0.368 ms 1 Yes /classes/Product.php:3539
661
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1209 LIMIT 1
0.368 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
724
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.367 ms 1 /classes/module/Module.php:2664
696
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1378
0.367 ms 3 /classes/Product.php:3420
244
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 752
ORDER BY f.position ASC
0.366 ms 1 Yes /classes/Product.php:6024
648
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2387
0.366 ms 2 /classes/Product.php:3420
528
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2390) AND (b.`id_shop` = 1) LIMIT 1
0.365 ms 1 /src/Adapter/EntityMapper.php:71
670
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2391 LIMIT 1
0.365 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
673
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1294 LIMIT 1
0.365 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
685
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 762 LIMIT 1
0.365 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
159
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 689)
0.364 ms 1 /classes/Product.php:3860
488
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2384) AND (b.`id_shop` = 1) LIMIT 1
0.364 ms 1 /src/Adapter/EntityMapper.php:71
575
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c WHERE c.id_category = 22 LIMIT 1
0.364 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
230
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2386)
0.363 ms 1 /classes/Product.php:3860
294
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2389
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
717
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.363 ms 1 /classes/Category.php:2239
649
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2387 LIMIT 1
0.363 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
713
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c LEFT JOIN och438iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 22 AND s.id_shop = 1 LIMIT 1
0.362 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
226
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 693
ORDER BY f.position ASC
0.361 ms 1 Yes /classes/Product.php:6024
520
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 755
ORDER BY `position`
0.361 ms 1 Yes /classes/Product.php:3539
551
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 762
0.360 ms 1 /classes/Product.php:2899
616
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2383 LIMIT 1
0.360 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
655
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 755 LIMIT 1
0.360 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
607
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 743 LIMIT 1
0.360 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
688
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2393 LIMIT 1
0.359 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
691
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1270 LIMIT 1
0.359 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
703
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1438 LIMIT 1
0.359 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
146
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2382
ORDER BY f.position ASC
0.359 ms 1 Yes /classes/Product.php:6024
697
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1378 LIMIT 1
0.358 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
700
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2395 LIMIT 1
0.358 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
682
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1364 LIMIT 1
0.356 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
628
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 690 LIMIT 1
0.355 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
654
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 755
0.355 ms 2 /classes/Product.php:3420
604
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2381 LIMIT 1
0.353 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
610
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 678 LIMIT 1
0.353 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
679
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2392 LIMIT 1
0.353 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
511
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 694
ORDER BY `position`
0.352 ms 1 Yes /classes/Product.php:3539
613
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2382 LIMIT 1
0.352 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
619
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 689 LIMIT 1
0.352 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
711
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitelementor" LIMIT 1
0.352 ms 1 /classes/module/Module.php:2664
164
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 689
ORDER BY f.position ASC
0.351 ms 1 Yes /classes/Product.php:6024
517
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2388
ORDER BY `position`
0.351 ms 1 Yes /classes/Product.php:3539
690
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1270
0.351 ms 2 /classes/Product.php:3420
601
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2381
0.350 ms 2 /classes/Product.php:3420
631
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2385 LIMIT 1
0.350 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
642
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 752
0.350 ms 2 /classes/Product.php:3420
663
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2390
0.350 ms 2 /classes/Product.php:3420
155
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2383
ORDER BY f.position ASC
0.349 ms 1 Yes /classes/Product.php:6024
256
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 694
ORDER BY f.position ASC
0.349 ms 1 Yes /classes/Product.php:6024
198
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.349 ms 1 /classes/Product.php:5670
606
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 743
0.349 ms 2 /classes/Product.php:3420
514
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2387
ORDER BY `position`
0.348 ms 1 Yes /classes/Product.php:3539
523
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2389
ORDER BY `position`
0.348 ms 1 Yes /classes/Product.php:3539
612
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2382
0.348 ms 2 /classes/Product.php:3420
645
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 694
0.348 ms 2 /classes/Product.php:3420
722
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.348 ms 1 /classes/module/Module.php:2664
127
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 743
ORDER BY f.position ASC
0.347 ms 1 Yes /classes/Product.php:6024
622
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2384 LIMIT 1
0.347 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
709
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 756 LIMIT 1
0.347 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
206
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 749
AND image_shop.`cover` = 1 LIMIT 1
0.346 ms 1 /classes/Product.php:3570
289
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2389)
0.345 ms 1 /classes/Product.php:3860
449
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1438
ORDER BY f.position ASC
0.345 ms 1 Yes /classes/Product.php:6024
592
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `och438cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.345 ms 1 /classes/Cart.php:1300
706
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2396 LIMIT 1
0.344 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
173
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2384
ORDER BY f.position ASC
0.343 ms 1 Yes /classes/Product.php:6024
218
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 693
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 1 /classes/Product.php:3570
553
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2393
ORDER BY `position`
0.343 ms 1 Yes /classes/Product.php:3539
483
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2383
ORDER BY `position`
0.343 ms 1 Yes /classes/Product.php:3539
556
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1270
ORDER BY `position`
0.343 ms 1 Yes /classes/Product.php:3539
726
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitpopup" LIMIT 1
0.343 ms 1 /classes/module/Module.php:2664
141
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2382)
0.342 ms 1 /classes/Product.php:3860
239
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 752)
0.342 ms 1 /classes/Product.php:3860
508
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 752
ORDER BY `position`
0.341 ms 1 Yes /classes/Product.php:3539
636
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 693
0.341 ms 2 /classes/Product.php:3420
491
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 747
ORDER BY `position`
0.340 ms 1 Yes /classes/Product.php:3539
378
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 762
AND image_shop.`cover` = 1 LIMIT 1
0.339 ms 1 /classes/Product.php:3570
458
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2396
ORDER BY f.position ASC
0.339 ms 1 Yes /classes/Product.php:6024
639
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2386
0.339 ms 2 /classes/Product.php:3420
684
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 762
0.339 ms 2 /classes/Product.php:3420
260
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2387)
0.338 ms 1 /classes/Product.php:3860
417
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2394
ORDER BY f.position ASC
0.337 ms 1 Yes /classes/Product.php:6024
618
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 689
0.337 ms 2 /classes/Product.php:3420
669
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2391
0.337 ms 2 /classes/Product.php:3420
672
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1294
0.337 ms 2 /classes/Product.php:3420
388
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 762
ORDER BY f.position ASC
0.337 ms 1 Yes /classes/Product.php:6024
687
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2393
0.337 ms 2 /classes/Product.php:3420
624
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 747
0.336 ms 2 /classes/Product.php:3420
346
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1294
ORDER BY f.position ASC
0.336 ms 1 Yes /classes/Product.php:6024
221
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 693)
0.335 ms 1 /classes/Product.php:3860
372
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1364)
0.335 ms 1 /classes/Product.php:3860
570
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2396
ORDER BY `position`
0.335 ms 1 Yes /classes/Product.php:3539
693
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2394
0.335 ms 2 /classes/Product.php:3420
138
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2382
AND image_shop.`cover` = 1 LIMIT 1
0.334 ms 1 /classes/Product.php:3570
150
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2383)
0.334 ms 1 /classes/Product.php:3860
168
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2384)
0.334 ms 1 /classes/Product.php:3860
285
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 755
ORDER BY f.position ASC
0.334 ms 1 Yes /classes/Product.php:6024
627
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 690
0.334 ms 2 /classes/Product.php:3420
681
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1364
0.334 ms 2 /classes/Product.php:3420
621
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2384
0.333 ms 2 /classes/Product.php:3420
699
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2395
0.333 ms 2 /classes/Product.php:3420
702
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1438
0.333 ms 3 /classes/Product.php:3420
630
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2385
0.332 ms 2 /classes/Product.php:3420
615
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2383
0.332 ms 2 /classes/Product.php:3420
236
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 752
AND image_shop.`cover` = 1 LIMIT 1
0.331 ms 1 /classes/Product.php:3570
269
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2388)
0.331 ms 1 /classes/Product.php:3860
581
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `och438currency` c
LEFT JOIN och438currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.331 ms 1 /classes/Currency.php:1134
357
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 761
ORDER BY f.position ASC
0.330 ms 1 Yes /classes/Product.php:6024
366
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2392
ORDER BY f.position ASC
0.330 ms 1 Yes /classes/Product.php:6024
392
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2393)
0.330 ms 1 /classes/Product.php:3860
444
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1438)
0.330 ms 1 /classes/Product.php:3860
505
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2386
ORDER BY `position`
0.330 ms 1 Yes /classes/Product.php:3539
526
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1209
ORDER BY `position`
0.330 ms 2 Yes /classes/Product.php:3539
156
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 689
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
224
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:453
275
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 755
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
436
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2395
ORDER BY f.position ASC
0.329 ms 1 Yes /classes/Product.php:6024
714
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_categorytree" LIMIT 1
0.329 ms 1 /classes/module/Module.php:2664
326
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1189
ORDER BY f.position ASC
0.329 ms 1 Yes /classes/Product.php:6024
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2385
AND image_shop.`cover` = 1 LIMIT 1
0.328 ms 1 /classes/Product.php:3570
335
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2391
ORDER BY f.position ASC
0.328 ms 1 Yes /classes/Product.php:6024
609
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 678
0.328 ms 2 /classes/Product.php:3420
708
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 756
0.328 ms 2 /classes/Product.php:3420
544
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2392
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1209
ORDER BY f.position ASC
0.327 ms 1 Yes /classes/Product.php:6024
550
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 762
ORDER BY `position`
0.327 ms 1 Yes /classes/Product.php:3539
375
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1364) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:453
657
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2389
0.327 ms 2 /classes/Product.php:3420
705
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2396
0.327 ms 2 /classes/Product.php:3420
165
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2384
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
181
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 747)
0.326 ms 1 /classes/Product.php:3860
245
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 694
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
266
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2388
AND image_shop.`cover` = 1 LIMIT 1
0.326 ms 1 /classes/Product.php:3570
94
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2381
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
361
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2392)
0.325 ms 1 /classes/Product.php:3860
474
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 743
ORDER BY `position`
0.325 ms 1 Yes /classes/Product.php:3539
257
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2387
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
288
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2389 LIMIT 1
0.323 ms 1 /classes/SpecificPrice.php:435
427
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1378
ORDER BY f.position ASC
0.323 ms 1 Yes /classes/Product.php:6024
660
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1209
0.323 ms 2 /classes/Product.php:3420
529
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2390
ORDER BY `position`
0.322 ms 1 Yes /classes/Product.php:3539
251
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 694)
0.321 ms 1 /classes/Product.php:3860
565
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2395
ORDER BY `position`
0.320 ms 1 Yes /classes/Product.php:3539
112
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 743
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 1 /classes/Product.php:3570
147
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2383
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 1 /classes/Product.php:3570
187
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 690
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 1 /classes/Product.php:3570
315
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2390
ORDER BY f.position ASC
0.319 ms 1 Yes /classes/Product.php:6024
347
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 761
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 1 /classes/Product.php:3570
401
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1270
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 1 /classes/SpecificPrice.php:256
559
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2394
ORDER BY `position`
0.318 ms 1 Yes /classes/Product.php:3539
209
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 749 LIMIT 1
0.317 ms 1 /classes/SpecificPrice.php:435
212
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 749)
0.317 ms 1 /classes/Product.php:3860
295
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1209
AND image_shop.`cover` = 1 LIMIT 1
0.316 ms 2 /classes/Product.php:3570
725
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.316 ms 1 /classes/module/Module.php:2137
122
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 743)
0.315 ms 1 /classes/Product.php:3860
227
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2386
AND image_shop.`cover` = 1 LIMIT 1
0.314 ms 1 /classes/Product.php:3570
548
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1364
0.314 ms 1 /classes/Product.php:2899
582
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_languageselector" LIMIT 1
0.314 ms 1 /classes/module/Module.php:2664
108
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.313 ms 0 /classes/tax/TaxRulesTaxManager.php:100
502
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 693
ORDER BY `position`
0.313 ms 1 Yes /classes/Product.php:3539
603
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 83 AND `id_shop` = 1 LIMIT 1
0.313 ms 1 /classes/module/Module.php:2137
719
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 22 LIMIT 1
0.312 ms 1 /classes/Category.php:1584
418
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1378
AND image_shop.`cover` = 1 LIMIT 1
0.311 ms 1 /classes/Product.php:3570
422
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1378)
0.311 ms 1 /classes/Product.php:3860
128
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 678
AND image_shop.`cover` = 1 LIMIT 1
0.311 ms 1 /classes/Product.php:3570
409
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2394
AND image_shop.`cover` = 1 LIMIT 1
0.311 ms 1 /classes/Product.php:3570
65
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.310 ms 1 /classes/Category.php:2446
174
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 747
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
249
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 694
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.310 ms 1 /classes/SpecificPrice.php:256
286
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2389
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
389
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2393
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
489
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2384
ORDER BY `position`
0.310 ms 1 Yes /classes/Product.php:3539
535
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2391
ORDER BY `position`
0.310 ms 1 Yes /classes/Product.php:3539
587
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.310 ms 1 /classes/module/Module.php:2137
280
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 755)
0.309 ms 1 /classes/Product.php:3860
431
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2395)
0.309 ms 1 /classes/Product.php:3860
462
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 756)
0.309 ms 1 /classes/Product.php:3860
727
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1
0.309 ms 1 /classes/module/Module.php:2137
330
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2391)
0.308 ms 1 /classes/Product.php:3860
486
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 689
ORDER BY `position`
0.308 ms 1 Yes /classes/Product.php:3539
240
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 752 AND id_shop=1 LIMIT 1
0.308 ms 1 /classes/Product.php:6884
428
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2395
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
477
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 678
ORDER BY `position`
0.308 ms 1 Yes /classes/Product.php:3539
410
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.307 ms 1 /classes/Product.php:5670
542
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 761
0.307 ms 1 /classes/Product.php:2899
715
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.307 ms 1 /classes/module/Module.php:2137
199
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2385 LIMIT 1
0.306 ms 1 /classes/SpecificPrice.php:435
437
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1438
AND image_shop.`cover` = 1 LIMIT 1
0.306 ms 1 /classes/Product.php:3570
450
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2396
AND image_shop.`cover` = 1 LIMIT 1
0.305 ms 1 /classes/Product.php:3570
480
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2382
ORDER BY `position`
0.305 ms 1 Yes /classes/Product.php:3539
254
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
398
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1270
AND image_shop.`cover` = 1 LIMIT 1
0.305 ms 1 /classes/Product.php:3570
597
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.305 ms 1 /classes/module/Module.php:2664
149
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2383 LIMIT 1
0.304 ms 1 /classes/SpecificPrice.php:435
238
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 752 LIMIT 1
0.304 ms 1 /classes/SpecificPrice.php:435
471
SELECT SQL_NO_CACHE state FROM och438feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.304 ms 1 /classes/FeatureFlag.php:105
560
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2394
0.304 ms 1 /classes/Product.php:2899
261
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2387 AND id_shop=1 LIMIT 1
0.303 ms 1 /classes/Product.php:6884
316
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1189
AND image_shop.`cover` = 1 LIMIT 1
0.303 ms 1 /classes/Product.php:3570
383
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 762)
0.303 ms 1 /classes/Product.php:3860
438
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.303 ms 1 /classes/Product.php:5670
494
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 690
ORDER BY `position`
0.303 ms 1 Yes /classes/Product.php:3539
459
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 756
AND image_shop.`cover` = 1 LIMIT 1
0.302 ms 2 /classes/Product.php:3570
579
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.302 ms 1 /classes/module/Module.php:2664
497
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2385
ORDER BY `position`
0.301 ms 1 Yes /classes/Product.php:3539
712
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.301 ms 1 /classes/module/Module.php:2137
728
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.301 ms 1 /classes/module/Module.php:2664
593
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_shoppingcart" LIMIT 1
0.300 ms 1 /classes/module/Module.php:2664
723
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.300 ms 1 /classes/module/Module.php:2137
97
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 0 LIMIT 1
0.299 ms 1 /classes/SpecificPrice.php:426
132
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 678)
0.299 ms 1 /classes/Product.php:3860
321
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1189)
0.299 ms 1 /classes/Product.php:3860
403
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1270)
0.299 ms 1 /classes/Product.php:3860
509
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 752
0.299 ms 1 /classes/Product.php:2899
590
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsearch" LIMIT 1
0.299 ms 1 /classes/module/Module.php:2664
599
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.298 ms 1 /classes/module/Module.php:2664
729
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.298 ms 1 /classes/module/Module.php:2137
242
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 752) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.298 ms 1 /classes/stock/StockAvailable.php:453
412
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2394)
0.298 ms 1 /classes/Product.php:3860
545
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2392
0.297 ms 1 /classes/Product.php:2899
184
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 747) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:453
162
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 689) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.296 ms 1 /classes/stock/StockAvailable.php:453
237
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.296 ms 1 /classes/Product.php:5670
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1209)
0.296 ms 1 /classes/Product.php:3860
453
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2396)
0.296 ms 1 /classes/Product.php:3860
584
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.296 ms 1 /classes/module/Module.php:2664
595
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.296 ms 1 /classes/module/Module.php:2664
358
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2392
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
158
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 689 LIMIT 1
0.294 ms 1 /classes/SpecificPrice.php:435
231
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2386 AND id_shop=1 LIMIT 1
0.294 ms 1 /classes/Product.php:6884
336
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1294
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
367
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1364
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
512
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 694
0.294 ms 1 /classes/Product.php:2899
515
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2387
0.294 ms 1 /classes/Product.php:2899
518
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2388
0.294 ms 1 /classes/Product.php:2899
160
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 689 AND id_shop=1 LIMIT 1
0.293 ms 1 /classes/Product.php:6884
327
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2391
AND image_shop.`cover` = 1 LIMIT 1
0.293 ms 1 /classes/Product.php:3570
380
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 762 LIMIT 1
0.293 ms 1 /classes/SpecificPrice.php:435
109
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2381) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
215
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 749) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2390
AND image_shop.`cover` = 1 LIMIT 1
0.292 ms 1 /classes/Product.php:3570
310
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2390)
0.292 ms 1 /classes/Product.php:3860
352
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 761)
0.292 ms 1 /classes/Product.php:3860
461
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 756 LIMIT 1
0.292 ms 1 /classes/SpecificPrice.php:435
554
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2393
0.292 ms 1 /classes/Product.php:2899
341
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1294)
0.292 ms 1 /classes/Product.php:3860
263
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2387) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
441
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1438 LIMIT 1
0.291 ms 1 /classes/SpecificPrice.php:435
524
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2389
0.291 ms 1 /classes/Product.php:2899
140
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2382 LIMIT 1
0.291 ms 1 /classes/SpecificPrice.php:435
153
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2383) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
720
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c
WHERE c.`id_category` = 2 LIMIT 1
0.291 ms 1 /classes/Category.php:1589
190
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 690 LIMIT 1
0.290 ms 1 /classes/SpecificPrice.php:435
259
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2387 LIMIT 1
0.290 ms 1 /classes/SpecificPrice.php:435
268
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2388 LIMIT 1
0.290 ms 1 /classes/SpecificPrice.php:435
580
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.290 ms 1 /classes/module/Module.php:2137
248
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 694 LIMIT 1
0.289 ms 1 /classes/SpecificPrice.php:435
373
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1364 AND id_shop=1 LIMIT 1
0.289 ms 1 /classes/Product.php:6884
379
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.289 ms 1 /classes/Product.php:5670
600
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 64 AND `id_shop` = 1 LIMIT 1
0.289 ms 1 /classes/module/Module.php:2137
219
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.288 ms 1 /classes/Product.php:5670
229
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2386 LIMIT 1
0.288 ms 1 /classes/SpecificPrice.php:435
130
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 11
AND `active` = 1 LIMIT 1
0.287 ms 1 /classes/Manufacturer.php:312
201
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2385 AND id_shop=1 LIMIT 1
0.287 ms 1 /classes/Product.php:6884
210
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 749
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.287 ms 0 /classes/SpecificPrice.php:256
139
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.287 ms 1 /classes/Product.php:5670
98
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2381 LIMIT 1
0.286 ms 1 /classes/SpecificPrice.php:435
228
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.286 ms 1 /classes/Product.php:5670
465
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 756) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
527
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1209
0.286 ms 1 /classes/Product.php:2899
598
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.286 ms 1 /classes/module/Module.php:2137
220
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 693 LIMIT 1
0.285 ms 1 /classes/SpecificPrice.php:435
222
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 693 AND id_shop=1 LIMIT 1
0.284 ms 1 /classes/Product.php:6884
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 690) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
246
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.284 ms 1 /classes/Product.php:5670
530
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2390
0.284 ms 1 /classes/Product.php:2899
591
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.284 ms 1 /classes/module/Module.php:2137
178
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 747 LIMIT 1
0.283 ms 1 /classes/SpecificPrice.php:435
144
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2382) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.282 ms 1 /classes/stock/StockAvailable.php:453
574
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 756
0.282 ms 1 /classes/Product.php:2899
171
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2384) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
434
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2395) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
456
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2396) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
452
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2396 LIMIT 1
0.281 ms 1 /classes/SpecificPrice.php:435
104
SELECT SQL_NO_CACHE *
FROM `och438tax` a
WHERE (a.`id_tax` = 31) LIMIT 1
0.280 ms 1 /src/Adapter/EntityMapper.php:71
125
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 743) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
131
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 678 LIMIT 1
0.280 ms 1 /classes/SpecificPrice.php:435
213
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 749 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6884
233
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2386) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
247
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 68
AND `active` = 1 LIMIT 1
0.280 ms 1 /classes/Manufacturer.php:312
232
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2386 AND `id_group` = 1 LIMIT 1
0.280 ms 0 /classes/GroupReduction.php:153
318
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1189 LIMIT 1
0.280 ms 1 /classes/SpecificPrice.php:435
568
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1438
0.280 ms 1 /classes/Product.php:2899
188
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.279 ms 1 /classes/Product.php:5670
203
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2385) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
281
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 755 AND id_shop=1 LIMIT 1
0.279 ms 1 /classes/Product.php:6884
272
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2388) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.278 ms 1 /classes/stock/StockAvailable.php:453
148
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.277 ms 1 /classes/Product.php:5670
399
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.277 ms 1 /classes/Product.php:5670
557
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1270
0.277 ms 1 /classes/Product.php:2899
571
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2396
0.277 ms 1 /classes/Product.php:2899
521
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 755
0.277 ms 1 /classes/Product.php:2899
167
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2384 LIMIT 1
0.276 ms 1 /classes/SpecificPrice.php:435
470
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2381
0.276 ms 1 /classes/Product.php:2899
506
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2386
0.276 ms 1 /classes/Product.php:2899
258
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.276 ms 1 /classes/Product.php:5670
283
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 755) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.276 ms 1 /classes/stock/StockAvailable.php:453
539
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1294
0.276 ms 1 /classes/Product.php:2899
270
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2388 AND id_shop=1 LIMIT 1
0.275 ms 1 /classes/Product.php:6884
151
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2383 AND id_shop=1 LIMIT 1
0.275 ms 1 /classes/Product.php:6884
252
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 694 AND id_shop=1 LIMIT 1
0.275 ms 1 /classes/Product.php:6884
290
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2389 AND id_shop=1 LIMIT 1
0.275 ms 1 /classes/Product.php:6884
588
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcompare" LIMIT 1
0.275 ms 1 /classes/module/Module.php:2664
118
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `from` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.274 ms 1 /classes/SpecificPrice.php:377
495
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 690
0.274 ms 1 /classes/Product.php:2899
135
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 678) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
583
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.274 ms 1 /classes/module/Module.php:2137
142
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2382 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6884
277
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 755 LIMIT 1
0.273 ms 1 /classes/SpecificPrice.php:435
472
SELECT SQL_NO_CACHE * FROM `och438image_type`
0.273 ms 8 /classes/ImageType.php:161
596
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.273 ms 1 /classes/module/Module.php:2137
161
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 689 AND `id_group` = 1 LIMIT 1
0.272 ms 0 /classes/GroupReduction.php:153
182
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 747 AND id_shop=1 LIMIT 1
0.272 ms 1 /classes/Product.php:6884
287
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.272 ms 1 /classes/Product.php:5670
292
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2389) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1209
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.272 ms 1 /classes/SpecificPrice.php:256
406
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1270) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
585
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.272 ms 1 /classes/module/Module.php:2137
169
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2384 AND id_shop=1 LIMIT 1
0.271 ms 1 /classes/Product.php:6884
276
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.271 ms 1 /classes/Product.php:5670
533
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1189
0.271 ms 1 /classes/Product.php:2899
430
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2395 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
100
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2381 AND id_shop=1 LIMIT 1
0.270 ms 1 /classes/Product.php:6884
105
SELECT SQL_NO_CACHE *
FROM `och438tax_lang`
WHERE `id_tax` = 31
0.270 ms 1 /src/Adapter/EntityMapper.php:79
106
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2381 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:153
152
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2383 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:153
442
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1438
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.270 ms 1 /classes/SpecificPrice.php:256
129
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.270 ms 1 /classes/Product.php:5670
179
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 747
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.270 ms 0 /classes/SpecificPrice.php:256
202
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2385 AND `id_group` = 1 LIMIT 1
0.270 ms 0 /classes/GroupReduction.php:153
386
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 762) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
586
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitwishlist" LIMIT 1
0.270 ms 1 /classes/module/Module.php:2664
594
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 32 AND `id_shop` = 1 LIMIT 1
0.270 ms 1 /classes/module/Module.php:2137
267
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
113
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
278
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 755
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:256
563
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1378
0.269 ms 1 /classes/Product.php:2899
119
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `to` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.268 ms 1 /classes/SpecificPrice.php:381
262
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2387 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:153
349
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 761 LIMIT 1
0.268 ms 1 /classes/SpecificPrice.php:435
374
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1364 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:153
425
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1378) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.268 ms 1 /classes/stock/StockAvailable.php:453
589
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 69 AND `id_shop` = 1 LIMIT 1
0.268 ms 1 /classes/module/Module.php:2137
157
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
223
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 693 AND `id_group` = 1 LIMIT 1
0.267 ms 0 /classes/GroupReduction.php:153
411
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2394 LIMIT 1
0.267 ms 1 /classes/SpecificPrice.php:435
324
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1189) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
447
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1438) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
484
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2383
0.266 ms 1 /classes/Product.php:2899
455
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2396 AND `id_group` = 1 LIMIT 1
0.266 ms 0 /classes/GroupReduction.php:153
329
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2391 LIMIT 1
0.265 ms 1 /classes/SpecificPrice.php:435
333
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2391) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:453
364
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2392) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:453
498
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2385
0.265 ms 1 /classes/Product.php:2899
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 690 AND id_shop=1 LIMIT 1
0.265 ms 1 /classes/Product.php:6884
241
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 752 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:153
353
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 761 AND id_shop=1 LIMIT 1
0.264 ms 1 /classes/Product.php:6884
115
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 743 LIMIT 1
0.264 ms 1 /classes/SpecificPrice.php:435
166
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.264 ms 1 /classes/Product.php:5670
337
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.264 ms 1 /classes/Product.php:5670
487
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 689
0.264 ms 1 /classes/Product.php:2899
503
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 693
0.264 ms 1 /classes/Product.php:2899
536
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2391
0.264 ms 1 /classes/Product.php:2899
360
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2392 LIMIT 1
0.263 ms 1 /classes/SpecificPrice.php:435
464
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 756 AND `id_group` = 1 LIMIT 1
0.263 ms 0 /classes/GroupReduction.php:153
500
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 749
0.263 ms 1 /classes/Product.php:2899
95
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 22 LIMIT 1
0.262 ms 1 /classes/Category.php:1373
298
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1209 LIMIT 1
0.262 ms 1 /classes/SpecificPrice.php:435
400
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1270 LIMIT 1
0.262 ms 1 /classes/SpecificPrice.php:435
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1209 AND id_shop=1 LIMIT 1
0.261 ms 1 /classes/Product.php:6884
415
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2394) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.261 ms 1 /classes/stock/StockAvailable.php:453
566
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2395
0.261 ms 1 /classes/Product.php:2899
189
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 6
AND `active` = 1 LIMIT 1
0.261 ms 1 /classes/Manufacturer.php:312
454
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2396 AND id_shop=1 LIMIT 1
0.261 ms 1 /classes/Product.php:6884
143
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2382 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:153
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1209) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.260 ms 1 /classes/stock/StockAvailable.php:453
338
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1294 LIMIT 1
0.260 ms 1 /classes/SpecificPrice.php:435
170
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2384 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:153
319
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1189
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.260 ms 1 /classes/SpecificPrice.php:256
460
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.260 ms 1 /classes/Product.php:5670
463
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 756 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6884
395
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2393) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.259 ms 1 /classes/stock/StockAvailable.php:453
451
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.259 ms 1 /classes/Product.php:5670
96
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.259 ms 1 /classes/Product.php:5670
393
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2393 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6884
214
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 749 AND `id_group` = 1 LIMIT 1
0.258 ms 0 /classes/GroupReduction.php:153
296
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.257 ms 1 /classes/Product.php:5670
344
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1294) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
355
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 761) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:453
369
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1364 LIMIT 1
0.257 ms 1 /classes/SpecificPrice.php:435
391
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2393 LIMIT 1
0.256 ms 1 /classes/SpecificPrice.php:435
419
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.256 ms 1 /classes/Product.php:5670
421
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1378 LIMIT 1
0.256 ms 1 /classes/SpecificPrice.php:435
492
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 747
0.256 ms 1 /classes/Product.php:2899
328
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.255 ms 1 /classes/Product.php:5670
359
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.255 ms 1 /classes/Product.php:5670
475
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 743
0.255 ms 1 /classes/Product.php:2899
478
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 678
0.255 ms 1 /classes/Product.php:2899
107
SELECT SQL_NO_CACHE `reduction`
FROM `och438group`
WHERE `id_group` = 1 LIMIT 1
0.255 ms 1 /classes/Group.php:151
313
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2390) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.255 ms 1 /classes/stock/StockAvailable.php:453
350
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 761
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.255 ms 1 /classes/SpecificPrice.php:256
429
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.255 ms 1 /classes/Product.php:5670
490
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2384
0.255 ms 1 /classes/Product.php:2899
114
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 13
AND `active` = 1 LIMIT 1
0.254 ms 1 /classes/Manufacturer.php:312
175
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.254 ms 1 /classes/Product.php:5670
420
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 14
AND `active` = 1 LIMIT 1
0.254 ms 1 /classes/Manufacturer.php:312
271
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2388 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:153
120
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 743
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.253 ms 1 /classes/SpecificPrice.php:256
282
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 755 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:153
183
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 747 AND `id_group` = 1 LIMIT 1
0.251 ms 0 /classes/GroupReduction.php:153
348
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.251 ms 1 /classes/Product.php:5670
440
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 58
AND `active` = 1 LIMIT 1
0.251 ms 1 /classes/Manufacturer.php:312
481
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2382
0.250 ms 1 /classes/Product.php:2899
123
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 743 AND id_shop=1 LIMIT 1
0.250 ms 1 /classes/Product.php:6884
368
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.250 ms 1 /classes/Product.php:5670
404
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1270 AND id_shop=1 LIMIT 1
0.249 ms 1 /classes/Product.php:6884
445
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1438 AND id_shop=1 LIMIT 1
0.249 ms 1 /classes/Product.php:6884
432
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2395 AND id_shop=1 LIMIT 1
0.248 ms 1 /classes/Product.php:6884
308
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.247 ms 1 /classes/Product.php:5670
309
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2390 LIMIT 1
0.247 ms 1 /classes/SpecificPrice.php:435
390
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.247 ms 1 /classes/Product.php:5670
253
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 694 AND `id_group` = 1 LIMIT 1
0.245 ms 0 /classes/GroupReduction.php:153
291
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2389 AND `id_group` = 1 LIMIT 1
0.245 ms 0 /classes/GroupReduction.php:153
317
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.244 ms 1 /classes/Product.php:5670
303
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1209 AND `id_group` = 1 LIMIT 1
0.244 ms 0 /classes/GroupReduction.php:153
381
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 762
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.244 ms 1 /classes/SpecificPrice.php:256
384
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 762 AND id_shop=1 LIMIT 1
0.243 ms 1 /classes/Product.php:6884
297
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 61
AND `active` = 1 LIMIT 1
0.243 ms 1 /classes/Manufacturer.php:312
362
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2392 AND id_shop=1 LIMIT 1
0.241 ms 1 /classes/Product.php:6884
193
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 690 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:153
370
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1364
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.240 ms 1 /classes/SpecificPrice.php:256
342
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1294 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6884
413
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2394 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6884
133
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 678 AND id_shop=1 LIMIT 1
0.239 ms 1 /classes/Product.php:6884
312
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2390 AND `id_group` = 1 LIMIT 1
0.239 ms 0 /classes/GroupReduction.php:153
339
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1294
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.239 ms 1 /classes/SpecificPrice.php:256
424
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1378 AND `id_group` = 1 LIMIT 1
0.239 ms 0 /classes/GroupReduction.php:153
423
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1378 AND id_shop=1 LIMIT 1
0.238 ms 1 /classes/Product.php:6884
124
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 743 AND `id_group` = 1 LIMIT 1
0.237 ms 0 /classes/GroupReduction.php:153
322
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1189 AND id_shop=1 LIMIT 1
0.237 ms 1 /classes/Product.php:6884
311
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2390 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6884
331
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2391 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6884
405
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1270 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:153
446
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1438 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:153
414
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2394 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:153
433
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2395 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:153
385
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 762 AND `id_group` = 1 LIMIT 1
0.232 ms 0 /classes/GroupReduction.php:153
332
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2391 AND `id_group` = 1 LIMIT 1
0.230 ms 0 /classes/GroupReduction.php:153
343
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1294 AND `id_group` = 1 LIMIT 1
0.230 ms 0 /classes/GroupReduction.php:153
134
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 678 AND `id_group` = 1 LIMIT 1
0.226 ms 0 /classes/GroupReduction.php:153
323
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1189 AND `id_group` = 1 LIMIT 1
0.226 ms 0 /classes/GroupReduction.php:153
354
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 761 AND `id_group` = 1 LIMIT 1
0.226 ms 0 /classes/GroupReduction.php:153
394
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2393 AND `id_group` = 1 LIMIT 1
0.224 ms 0 /classes/GroupReduction.php:153
363
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2392 AND `id_group` = 1 LIMIT 1
0.223 ms 0 /classes/GroupReduction.php:153

Doubles

37 queries
SELECT XX FROM `ochXXspecific_price` WHERE id_product = XX LIMIT XX
36 queries
SELECT image_shop.`id_image`
                    FROM `ochXXimage` i
                     INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
36 queries
SELECT name FROM ochXXcategory_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
36 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ochXXproduct` p
INNER JOIN `ochXXproduct_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `ochXXproduct_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
36 queries
                            SELECT `id_tax_rules_group`
                            FROM `ochXXproduct_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
36 queries
			SELECT `reduction`
			FROM `ochXXproduct_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
36 queries
SELECT SUM(quantity)
FROM `ochXXstock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
36 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `ochXXcart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `ochXXcart_product` cp JOIN `ochXXpack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ochXXproduct` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
36 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM ochXXfeature_product pf
                LEFT JOIN ochXXfeature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN ochXXfeature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN ochXXfeature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN ochXXfeature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
36 queries
SELECT *
FROM `ochXXproduct` a
LEFT JOIN `ochXXproduct_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `ochXXproduct_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
36 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `ochXXimage` i
             INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `ochXXimage_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
36 queries
SELECT `id_product_attribute`
            FROM `ochXXproduct_attribute`
            WHERE `id_product` = XX
36 queries
                SELECT `id_category` FROM `ochXXcategory_product`
                WHERE `id_product` = XX
36 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `ochXXiqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
36 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `ochXXproduct_attribute` pa
             INNER JOIN ochXXproduct_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `ochXXproduct_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `ochXXattribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `ochXXattribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
18 queries
SELECT *
FROM `ochXXcategory` a
LEFT JOIN `ochXXcategory_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `ochXXcategory_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
18 queries
SELECT `id_module` FROM `ochXXmodule_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
13 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `ochXXspecific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
13 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `ochXXspecific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
8 queries
				SELECT `name`
				FROM `ochXXmanufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
4 queries
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `ochXXattribute_group` ag INNER JOIN `ochXXattribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `ochXXattribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN ochXXattribute_group_shop attribute_group_shop
        ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX)  INNER JOIN ochXXattribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `ochXXlayered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
4 queries
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND cp.id_category IN (XX, XX, XX) GROUP BY p.id_product) p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN ochXXattribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `ochXXmodule` m
                LEFT JOIN `ochXXmodule_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `ochXXlang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `ochXXcategory_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND cp.id_category IN (XX, XX, XX) GROUP BY p.id_product) p INNER JOIN ochXXfeature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
2 queries
				SELECT tr.*
				FROM `ochXXtax_rule` tr
				JOIN `ochXXtax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT XX FROM `ochXXcart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

123 product
123 product_shop
88 product_attribute
74 cart_product
72 image
72 image_shop
72 product_attribute_shop
66 category_lang
55 specific_price
52 product_attribute_combination
52 category_product
49 stock_available
45 category
44 attribute
41 attribute_group
40 attribute_lang
38 feature_product
37 feature
37 feature_shop
37 feature_lang
37 product_lang
36 product_group_reduction_cache
36 pack
36 feature_value_lang
36 image_lang
36 iqitreviews_products
24 category_shop
22 module
21 module_shop
17 category_group
13 specific_price_priority
12 product_sale
9 manufacturer
7 hook
5 lang
5 currency
5 attribute_group_shop
5 attribute_group_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 attribute_shop
4 layered_indexable_attribute_lang_value
3 country
3 hook_alias
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 tax_rule
2 tax_rules_group
2 iqit_elementor_category
2 cart_rule
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 layered_category
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 manufacturer_shop
1 manufacturer_lang
1 layered_price_index
1 tax
1 tax_lang
1 feature_flag
1 iqit_elementor_category_shop
1 connections
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 42 /classes/Link.php:113 (__construct) [id: 747]
/classes/Link.php:113 (__construct) [id: 749]
/classes/Link.php:113 (__construct) [id: 1438]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2381]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 743]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 678]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2382]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2383]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 689]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2384]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 747]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 690]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2385]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 749]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 693]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2386]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 752]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 694]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2387]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2388]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 755]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2389]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1209]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2390]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1189]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2391]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1294]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 761]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2392]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1364]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 762]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2393]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1270]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2394]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1378]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2395]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1438]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2396]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 756]
/classes/Link.php:113 (__construct) [id: 747]
/classes/Link.php:113 (__construct) [id: 749]
/classes/Link.php:113 (__construct) [id: 1438]
Category 22 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 22]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 26]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 29]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 41]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 42]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 43]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 45]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 94]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 130]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 131]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 138]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 272]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 274]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 275]
/classes/Meta.php:379 (__construct) [id: 22]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Filters/Block.php:158 (__construct) [id: 22]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1768 (__construct) [id: 0]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Tax 1 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 31]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /classes/Smarty/SmartyDev.php
199 /vendor/smarty/smarty/libs/Smarty.class.php
200 /vendor/smarty/smarty/libs/functions.php
201 /vendor/smarty/smarty/libs/Autoloader.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
211 /config/smartyfront.config.inc.php
212 /classes/Smarty/SmartyResourceModule.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
215 /classes/Smarty/SmartyResourceParent.php
216 /classes/Smarty/SmartyLazyRegister.php
217 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
218 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
219 /classes/Customer.php
220 /classes/Group.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /classes/Dispatcher.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
231 /src/Adapter/SymfonyContainer.php
232 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
233 /src/Adapter/ContainerBuilder.php
234 /src/Adapter/Environment.php
235 /src/Core/EnvironmentInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
237 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
238 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
239 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
240 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
241 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
245 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
246 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
247 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
248 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
249 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
250 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
252 /vendor/symfony/contracts/Service/ResetInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
255 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
256 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
258 /vendor/symfony/contracts/Cache/ItemInterface.php
259 /vendor/psr/cache/src/CacheItemInterface.php
260 /vendor/psr/cache/src/CacheItemPoolInterface.php
261 /vendor/symfony/contracts/Cache/CacheInterface.php
262 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
264 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
266 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
267 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
268 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
269 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
270 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
271 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
319 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
321 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
323 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
324 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
325 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
326 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
330 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
331 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
332 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
333 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
334 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
335 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
336 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
337 /var/cache/dev/FrontContainer.php
338 /src/Adapter/Container/LegacyContainer.php
339 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
340 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
341 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
342 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
343 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
344 /vendor/psr/container/src/ContainerExceptionInterface.php
345 /vendor/psr/container/src/NotFoundExceptionInterface.php
346 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
347 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
348 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
349 /src/Adapter/Container/LegacyContainerInterface.php
350 /modules/blockwishlist/vendor/autoload.php
351 /modules/blockwishlist/vendor/composer/autoload_real.php
352 /modules/blockwishlist/vendor/composer/autoload_static.php
353 /modules/contactform/vendor/autoload.php
354 /modules/contactform/vendor/composer/autoload_real.php
355 /modules/contactform/vendor/composer/autoload_static.php
356 /modules/dashactivity/vendor/autoload.php
357 /modules/dashactivity/vendor/composer/autoload_real.php
358 /modules/dashactivity/vendor/composer/platform_check.php
359 /modules/dashactivity/vendor/composer/autoload_static.php
360 /modules/dashtrends/vendor/autoload.php
361 /modules/dashtrends/vendor/composer/autoload_real.php
362 /modules/dashtrends/vendor/composer/autoload_static.php
363 /modules/dashgoals/vendor/autoload.php
364 /modules/dashgoals/vendor/composer/autoload_real.php
365 /modules/dashgoals/vendor/composer/platform_check.php
366 /modules/dashgoals/vendor/composer/autoload_static.php
367 /modules/dashproducts/vendor/autoload.php
368 /modules/dashproducts/vendor/composer/autoload_real.php
369 /modules/dashproducts/vendor/composer/platform_check.php
370 /modules/dashproducts/vendor/composer/autoload_static.php
371 /modules/graphnvd3/vendor/autoload.php
372 /modules/graphnvd3/vendor/composer/autoload_real.php
373 /modules/graphnvd3/vendor/composer/autoload_static.php
374 /modules/gridhtml/vendor/autoload.php
375 /modules/gridhtml/vendor/composer/autoload_real.php
376 /modules/gridhtml/vendor/composer/autoload_static.php
377 /modules/gsitemap/vendor/autoload.php
378 /modules/gsitemap/vendor/composer/autoload_real.php
379 /modules/gsitemap/vendor/composer/platform_check.php
380 /modules/gsitemap/vendor/composer/autoload_static.php
381 /modules/pagesnotfound/vendor/autoload.php
382 /modules/pagesnotfound/vendor/composer/autoload_real.php
383 /modules/pagesnotfound/vendor/composer/platform_check.php
384 /modules/pagesnotfound/vendor/composer/autoload_static.php
385 /modules/productcomments/vendor/autoload.php
386 /modules/productcomments/vendor/composer/autoload_real.php
387 /modules/productcomments/vendor/composer/platform_check.php
388 /modules/productcomments/vendor/composer/autoload_static.php
389 /modules/ps_categorytree/vendor/autoload.php
390 /modules/ps_categorytree/vendor/composer/autoload_real.php
391 /modules/ps_categorytree/vendor/composer/platform_check.php
392 /modules/ps_categorytree/vendor/composer/autoload_static.php
393 /modules/ps_checkpayment/vendor/autoload.php
394 /modules/ps_checkpayment/vendor/composer/autoload_real.php
395 /modules/ps_checkpayment/vendor/composer/autoload_static.php
396 /modules/ps_crossselling/vendor/autoload.php
397 /modules/ps_crossselling/vendor/composer/autoload_real.php
398 /modules/ps_crossselling/vendor/composer/platform_check.php
399 /modules/ps_crossselling/vendor/composer/autoload_static.php
400 /modules/ps_currencyselector/vendor/autoload.php
401 /modules/ps_currencyselector/vendor/composer/autoload_real.php
402 /modules/ps_currencyselector/vendor/composer/autoload_static.php
403 /modules/ps_customeraccountlinks/vendor/autoload.php
404 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
405 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
406 /modules/ps_customersignin/vendor/autoload.php
407 /modules/ps_customersignin/vendor/composer/autoload_real.php
408 /modules/ps_customersignin/vendor/composer/autoload_static.php
409 /modules/ps_dataprivacy/vendor/autoload.php
410 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
411 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
412 /modules/ps_emailsubscription/vendor/autoload.php
413 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
414 /modules/ps_emailsubscription/vendor/composer/platform_check.php
415 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
416 /modules/ps_faviconnotificationbo/vendor/autoload.php
417 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
418 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
419 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
420 /modules/ps_languageselector/vendor/autoload.php
421 /modules/ps_languageselector/vendor/composer/autoload_real.php
422 /modules/ps_languageselector/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_wirepayment/vendor/autoload.php
430 /modules/ps_wirepayment/vendor/composer/autoload_real.php
431 /modules/ps_wirepayment/vendor/composer/platform_check.php
432 /modules/ps_wirepayment/vendor/composer/autoload_static.php
433 /modules/statsbestcategories/vendor/autoload.php
434 /modules/statsbestcategories/vendor/composer/autoload_real.php
435 /modules/statsbestcategories/vendor/composer/platform_check.php
436 /modules/statsbestcategories/vendor/composer/autoload_static.php
437 /modules/statsbestcustomers/vendor/autoload.php
438 /modules/statsbestcustomers/vendor/composer/autoload_real.php
439 /modules/statsbestcustomers/vendor/composer/platform_check.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestproducts/vendor/autoload.php
442 /modules/statsbestproducts/vendor/composer/autoload_real.php
443 /modules/statsbestproducts/vendor/composer/platform_check.php
444 /modules/statsbestproducts/vendor/composer/autoload_static.php
445 /modules/statsbestsuppliers/vendor/autoload.php
446 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
447 /modules/statsbestsuppliers/vendor/composer/platform_check.php
448 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
449 /modules/statsbestvouchers/vendor/autoload.php
450 /modules/statsbestvouchers/vendor/composer/autoload_real.php
451 /modules/statsbestvouchers/vendor/composer/platform_check.php
452 /modules/statsbestvouchers/vendor/composer/autoload_static.php
453 /modules/statscarrier/vendor/autoload.php
454 /modules/statscarrier/vendor/composer/autoload_real.php
455 /modules/statscarrier/vendor/composer/platform_check.php
456 /modules/statscarrier/vendor/composer/autoload_static.php
457 /modules/statscatalog/vendor/autoload.php
458 /modules/statscatalog/vendor/composer/autoload_real.php
459 /modules/statscatalog/vendor/composer/platform_check.php
460 /modules/statscatalog/vendor/composer/autoload_static.php
461 /modules/statscheckup/vendor/autoload.php
462 /modules/statscheckup/vendor/composer/autoload_real.php
463 /modules/statscheckup/vendor/composer/platform_check.php
464 /modules/statscheckup/vendor/composer/autoload_static.php
465 /modules/statsdata/vendor/autoload.php
466 /modules/statsdata/vendor/composer/autoload_real.php
467 /modules/statsdata/vendor/composer/autoload_static.php
468 /modules/statsforecast/vendor/autoload.php
469 /modules/statsforecast/vendor/composer/autoload_real.php
470 /modules/statsforecast/vendor/composer/platform_check.php
471 /modules/statsforecast/vendor/composer/autoload_static.php
472 /modules/statsnewsletter/vendor/autoload.php
473 /modules/statsnewsletter/vendor/composer/autoload_real.php
474 /modules/statsnewsletter/vendor/composer/platform_check.php
475 /modules/statsnewsletter/vendor/composer/autoload_static.php
476 /modules/statspersonalinfos/vendor/autoload.php
477 /modules/statspersonalinfos/vendor/composer/autoload_real.php
478 /modules/statspersonalinfos/vendor/composer/platform_check.php
479 /modules/statspersonalinfos/vendor/composer/autoload_static.php
480 /modules/statsproduct/vendor/autoload.php
481 /modules/statsproduct/vendor/composer/autoload_real.php
482 /modules/statsproduct/vendor/composer/platform_check.php
483 /modules/statsproduct/vendor/composer/autoload_static.php
484 /modules/statsregistrations/vendor/autoload.php
485 /modules/statsregistrations/vendor/composer/autoload_real.php
486 /modules/statsregistrations/vendor/composer/platform_check.php
487 /modules/statsregistrations/vendor/composer/autoload_static.php
488 /modules/statssales/vendor/autoload.php
489 /modules/statssales/vendor/composer/autoload_real.php
490 /modules/statssales/vendor/composer/platform_check.php
491 /modules/statssales/vendor/composer/autoload_static.php
492 /modules/statssearch/vendor/autoload.php
493 /modules/statssearch/vendor/composer/autoload_real.php
494 /modules/statssearch/vendor/composer/platform_check.php
495 /modules/statssearch/vendor/composer/autoload_static.php
496 /modules/statsstock/vendor/autoload.php
497 /modules/statsstock/vendor/composer/autoload_real.php
498 /modules/statsstock/vendor/composer/platform_check.php
499 /modules/statsstock/vendor/composer/autoload_static.php
500 /modules/psgdpr/vendor/autoload.php
501 /modules/psgdpr/vendor/composer/autoload_real.php
502 /modules/psgdpr/vendor/composer/autoload_static.php
503 /modules/ps_facetedsearch/vendor/autoload.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
505 /modules/ps_facetedsearch/vendor/composer/platform_check.php
506 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
507 /modules/iqitsociallogin/vendor/autoload.php
508 /modules/iqitsociallogin/vendor/composer/autoload_real.php
509 /modules/iqitsociallogin/vendor/composer/platform_check.php
510 /modules/iqitsociallogin/vendor/composer/autoload_static.php
511 /modules/ps_emailalerts/vendor/autoload.php
512 /modules/ps_emailalerts/vendor/composer/autoload_real.php
513 /modules/ps_emailalerts/vendor/composer/autoload_static.php
514 /modules/ps_googleanalytics/vendor/autoload.php
515 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
516 /modules/ps_googleanalytics/vendor/composer/platform_check.php
517 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
518 /modules/ph_simpleblog/vendor/autoload.php
519 /modules/ph_simpleblog/vendor/composer/autoload_real.php
520 /modules/ph_simpleblog/vendor/composer/platform_check.php
521 /modules/ph_simpleblog/vendor/composer/autoload_static.php
522 /modules/autoupgrade/vendor/autoload.php
523 /modules/autoupgrade/vendor/composer/autoload_real.php
524 /modules/autoupgrade/vendor/composer/autoload_static.php
525 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
526 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
527 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
528 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
529 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
530 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
531 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
532 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
533 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
534 /modules/iqitproductflags/vendor/autoload.php
535 /modules/iqitproductflags/vendor/composer/autoload_real.php
536 /modules/iqitproductflags/vendor/composer/platform_check.php
537 /modules/iqitproductflags/vendor/composer/autoload_static.php
538 /modules/iqitproductvariants/vendor/autoload.php
539 /modules/iqitproductvariants/vendor/composer/autoload_real.php
540 /modules/iqitproductvariants/vendor/composer/autoload_static.php
541 /src/Core/Hook/HookModuleFilter.php
542 /src/Core/Hook/HookModuleFilterInterface.php
543 /modules/ph_simpleblog/ph_simpleblog.php
544 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
545 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
546 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
547 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
548 /modules/ph_simpleblog/models/SimpleBlogCategory.php
549 /modules/ph_simpleblog/models/SimpleBlogPost.php
550 /modules/ph_simpleblog/models/SimpleBlogPostType.php
551 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
552 /modules/ph_simpleblog/models/SimpleBlogTag.php
553 /modules/ph_simpleblog/models/SimpleBlogComment.php
554 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
555 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
556 /modules/ph_simpleblog/classes/BlogPostsFinder.php
557 /modules/ph_simpleblog/controllers/front/default_list.php
558 /classes/controller/ModuleFrontController.php
559 /override/classes/controller/FrontController.php
560 /classes/controller/FrontController.php
561 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
562 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
563 /classes/Translate.php
564 /modules/ph_simpleblog/translations/es.php
565 /src/PrestaShopBundle/Translation/TranslatorComponent.php
566 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
567 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
568 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
569 /vendor/symfony/contracts/Translation/TranslatorInterface.php
570 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
571 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
572 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
573 /src/PrestaShopBundle/Translation/TranslatorInterface.php
574 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
575 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
576 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
577 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
578 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
579 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
580 /vendor/symfony/contracts/Translation/TranslatorTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
582 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
583 /var/cache/dev/translations/catalogue.es-ES.NXhscRe.php
584 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
585 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
587 /controllers/front/listing/CategoryController.php
588 /classes/controller/ProductListingFrontController.php
589 /classes/controller/ProductPresentingFrontController.php
590 /src/Adapter/Presenter/Object/ObjectPresenter.php
591 /src/Adapter/Presenter/PresenterInterface.php
592 /src/Adapter/Presenter/Cart/CartPresenter.php
593 /src/Adapter/Image/ImageRetriever.php
594 /classes/tax/TaxConfiguration.php
595 /classes/Smarty/TemplateFinder.php
596 /classes/assets/StylesheetManager.php
597 /classes/assets/AbstractAssetManager.php
598 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
599 /classes/assets/JavascriptManager.php
600 /classes/assets/CccReducer.php
601 /modules/iqitthemeeditor/iqitthemeeditor.php
602 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
603 /modules/iqitthemeeditor/translations/es.php
604 /classes/Category.php
605 /classes/webservice/WebserviceRequest.php
606 /src/Core/Localization/Locale/Repository.php
607 /src/Core/Localization/Locale/RepositoryInterface.php
608 /src/Core/Localization/CLDR/LocaleRepository.php
609 /src/Core/Localization/CLDR/LocaleDataSource.php
610 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
611 /src/Core/Data/Layer/AbstractDataLayer.php
612 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
613 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
614 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
615 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
616 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
617 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
618 /vendor/symfony/contracts/Cache/CacheTrait.php
619 /vendor/psr/cache/src/InvalidArgumentException.php
620 /vendor/psr/cache/src/CacheException.php
621 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
622 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
623 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
624 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
625 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
626 /src/Core/Localization/CLDR/Reader.php
627 /src/Core/Localization/CLDR/ReaderInterface.php
628 /src/Core/Localization/Currency/Repository.php
629 /src/Core/Localization/Currency/RepositoryInterface.php
630 /src/Core/Localization/Currency/CurrencyDataSource.php
631 /src/Core/Localization/Currency/DataSourceInterface.php
632 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
633 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
634 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
635 /src/Adapter/Currency/CurrencyDataProvider.php
636 /src/Core/Currency/CurrencyDataProviderInterface.php
637 /src/Adapter/LegacyContext.php
638 /src/Adapter/Tools.php
639 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
640 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
641 /vendor/prestashop/decimal/src/Operation/Rounding.php
642 /src/Core/Localization/Locale.php
643 /src/Core/Localization/LocaleInterface.php
644 /src/Core/Localization/Specification/Price.php
645 /src/Core/Localization/Specification/Number.php
646 /src/Core/Localization/Specification/NumberInterface.php
647 /src/Core/Localization/Specification/Factory.php
648 /src/Core/Localization/CLDR/LocaleData.php
649 /src/Core/Localization/CLDR/NumberSymbolsData.php
650 /src/Core/Localization/CLDR/CurrencyData.php
651 /src/Core/Localization/CLDR/Locale.php
652 /src/Core/Localization/CLDR/LocaleInterface.php
653 /src/Core/Localization/Specification/NumberSymbolList.php
654 /classes/Currency.php
655 /src/Core/Localization/Currency/LocalizedCurrencyId.php
656 /src/Core/Localization/Currency/CurrencyData.php
657 /src/Core/Localization/Currency/CurrencyCollection.php
658 /src/Core/Localization/Currency.php
659 /src/Core/Localization/CurrencyInterface.php
660 /src/Core/Localization/Specification/NumberCollection.php
661 /src/Core/Localization/Number/Formatter.php
662 /override/classes/Cart.php
663 /classes/Cart.php
664 /src/Adapter/AddressFactory.php
665 /override/classes/CartRule.php
666 /classes/CartRule.php
667 /classes/Product.php
668 /src/Core/Domain/Product/ValueObject/RedirectType.php
669 /src/Core/Util/DateTime/DateTime.php
670 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
671 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
672 /src/Core/Domain/Product/ValueObject/ProductType.php
673 /src/Core/Domain/Product/ValueObject/Reference.php
674 /src/Core/Domain/Product/ValueObject/Ean13.php
675 /src/Core/Domain/Product/ValueObject/Isbn.php
676 /src/Core/Domain/Product/ValueObject/Upc.php
677 /src/Core/Domain/Product/ProductSettings.php
678 /src/Core/Domain/Shop/ValueObject/ShopId.php
679 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
680 /modules/ps_emailsubscription/ps_emailsubscription.php
681 /src/Core/Module/WidgetInterface.php
682 /src/PrestaShopBundle/Translation/DomainNormalizer.php
683 /classes/Media.php
684 /modules/ps_emailalerts/ps_emailalerts.php
685 /modules/ps_emailalerts/MailAlert.php
686 /modules/iqitproductvariants/iqitproductvariants.php
687 /src/Adapter/Localization/LegacyTranslator.php
688 /src/Adapter/Presenter/Cart/CartLazyArray.php
689 /src/Adapter/Presenter/AbstractLazyArray.php
690 /src/Adapter/Product/PriceFormatter.php
691 /src/Core/Util/Inflector.php
692 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
693 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
694 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
695 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
696 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
697 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
698 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
699 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
700 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
701 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
702 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
703 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
704 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
705 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
706 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
707 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
708 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
709 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
710 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
711 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
712 /classes/Gender.php
713 /classes/Risk.php
714 /classes/Meta.php
715 /modules/revsliderprestashop/revsliderprestashop.php
716 /modules/revsliderprestashop/rev-loader.php
717 /modules/revsliderprestashop/includes/revslider_db.class.php
718 /modules/revsliderprestashop/includes/data.class.php
719 /modules/revsliderprestashop/includes/functions.class.php
720 /modules/revsliderprestashop/includes/em-integration.class.php
721 /modules/revsliderprestashop/includes/cssparser.class.php
722 /modules/revsliderprestashop/includes/woocommerce.class.php
723 /modules/revsliderprestashop/includes/wpml.class.php
724 /modules/revsliderprestashop/includes/colorpicker.class.php
725 /modules/revsliderprestashop/includes/navigation.class.php
726 /modules/revsliderprestashop/includes/object-library.class.php
727 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
728 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
729 /modules/revsliderprestashop/includes/extension.class.php
730 /modules/revsliderprestashop/includes/favorite.class.php
731 /modules/revsliderprestashop/includes/aq-resizer.class.php
732 /modules/revsliderprestashop/includes/external-sources.class.php
733 /modules/revsliderprestashop/includes/page-template.class.php
734 /modules/revsliderprestashop/includes/slider.class.php
735 /modules/revsliderprestashop/includes/slide.class.php
736 /modules/revsliderprestashop/includes/output.class.php
737 /modules/revsliderprestashop/public/revslider-front.class.php
738 /modules/revsliderprestashop/includes/backwards.php
739 /modules/revsliderprestashop/admin/includes/class-pclzip.php
740 /modules/revsliderprestashop/admin/includes/license.class.php
741 /modules/revsliderprestashop/admin/includes/addons.class.php
742 /modules/revsliderprestashop/admin/includes/template.class.php
743 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
744 /modules/revsliderprestashop/admin/includes/folder.class.php
745 /modules/revsliderprestashop/admin/includes/import.class.php
746 /modules/revsliderprestashop/admin/includes/export.class.php
747 /modules/revsliderprestashop/admin/includes/export-html.class.php
748 /modules/revsliderprestashop/admin/includes/newsletter.class.php
749 /modules/revsliderprestashop/admin/revslider-admin.class.php
750 /modules/revsliderprestashop/includes/update.class.php
751 /modules/revsliderprestashop/includes/resize-imag.php
752 /modules/revsliderprestashop/translations/es.php
753 /classes/Address.php
754 /classes/ImageType.php
755 /classes/State.php
756 /src/Core/Security/PasswordPolicyConfiguration.php
757 /src/Core/Configuration/DataConfigurationInterface.php
758 /src/Core/Filter/FrontEndObject/MainFilter.php
759 /src/Core/Filter/FilterInterface.php
760 /src/Core/Filter/FrontEndObject/CartFilter.php
761 /src/Core/Filter/HashMapWhitelistFilter.php
762 /src/Core/Filter/CollectionFilter.php
763 /src/Core/Filter/FrontEndObject/ProductFilter.php
764 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
765 /src/Core/Filter/FrontEndObject/CustomerFilter.php
766 /src/Core/Filter/FrontEndObject/ShopFilter.php
767 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
768 /modules/productcomments/productcomments.php
769 /modules/ps_shoppingcart/ps_shoppingcart.php
770 /modules/iqitcontactpage/iqitcontactpage.php
771 /modules/iqitcontactpage/translations/es.php
772 /modules/iqitcookielaw/iqitcookielaw.php
773 /modules/iqitcookielaw/translations/es.php
774 /modules/iqitcountdown/iqitcountdown.php
775 /modules/iqitcountdown/translations/es.php
776 /modules/iqitsociallogin/iqitsociallogin.php
777 /modules/iqitsociallogin/translations/es.php
778 /modules/ps_googleanalytics/ps_googleanalytics.php
779 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
780 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
781 /classes/Smarty/SmartyDevTemplate.php
782 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
783 /var/cache/dev/smarty/compile/warehouse/7f/93/a7/7f93a70bcc26a0e15d5a8f0ad7b21b4b42ad15c2_2.file.ps_googleanalytics.tpl.php
784 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
785 /classes/assets/PrestashopAssetsLibraries.php
786 /modules/iqitsizecharts/iqitsizecharts.php
787 /modules/iqitsizecharts/src/IqitSizeCharts.php
788 /modules/iqitsizecharts/translations/es.php
789 /modules/iqitwishlist/iqitwishlist.php
790 /modules/iqitwishlist/src/IqitWishlistProduct.php
791 /modules/iqitwishlist/translations/es.php
792 /modules/iqitreviews/iqitreviews.php
793 /modules/iqitreviews/src/IqitProductReview.php
794 /modules/iqitreviews/translations/es.php
795 /modules/iqitpopup/iqitpopup.php
796 /modules/iqitpopup/translations/es.php
797 /modules/iqitmegamenu/iqitmegamenu.php
798 /modules/iqitmegamenu/models/IqitMenuTab.php
799 /modules/iqitmegamenu/models/IqitMenuHtml.php
800 /modules/iqitmegamenu/models/IqitMenuLinks.php
801 /modules/iqitmegamenu/translations/es.php
802 /modules/iqitcompare/iqitcompare.php
803 /modules/iqitcompare/translations/es.php
804 /modules/iqitelementor/iqitelementor.php
805 /modules/iqitelementor/src/IqitElementorLanding.php
806 /modules/iqitelementor/src/IqitElementorTemplate.php
807 /modules/iqitelementor/src/IqitElementorProduct.php
808 /modules/iqitelementor/src/IqitElementorCategory.php
809 /modules/iqitelementor/src/IqitElementorContent.php
810 /modules/iqitelementor/src/iqitElementorWpHelper.php
811 /modules/iqitelementor/includes/plugin-elementor.php
812 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
813 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
814 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
815 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
816 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
817 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
818 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
819 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
820 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
821 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
822 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
823 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
824 /modules/iqitelementor/translations/es.php
825 /modules/iqitextendedproduct/iqitextendedproduct.php
826 /modules/iqitextendedproduct/src/IqitThreeSixty.php
827 /modules/iqitextendedproduct/src/IqitProductVideo.php
828 /modules/iqitextendedproduct/translations/es.php
829 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
830 /modules/iqitfreedeliverycount/translations/es.php
831 /src/Core/Product/Search/ProductSearchContext.php
832 /src/Core/Product/Search/ProductSearchQuery.php
833 /src/Core/Product/Search/SortOrder.php
834 /modules/ps_facetedsearch/ps_facetedsearch.php
835 /modules/ps_facetedsearch/src/HookDispatcher.php
836 /modules/ps_facetedsearch/src/Hook/Attribute.php
837 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
838 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
839 /modules/ps_facetedsearch/src/Hook/Category.php
840 /modules/ps_facetedsearch/src/Hook/Configuration.php
841 /modules/ps_facetedsearch/src/Hook/Design.php
842 /modules/ps_facetedsearch/src/Hook/Feature.php
843 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
844 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
845 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
846 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
847 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
848 /modules/ps_facetedsearch/src/Hook/Product.php
849 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
850 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
851 /modules/ps_facetedsearch/src/Filters/Provider.php
852 /modules/ps_facetedsearch/src/URLSerializer.php
853 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
854 /modules/ps_facetedsearch/src/Product/SearchProvider.php
855 /src/Core/Product/Search/FacetsRendererInterface.php
856 /src/Core/Product/Search/ProductSearchProviderInterface.php
857 /modules/ps_facetedsearch/src/Filters/Converter.php
858 /modules/ps_facetedsearch/src/Product/SearchFactory.php
859 /src/Core/Product/Search/ProductSearchResult.php
860 /classes/Combination.php
861 /modules/ps_facetedsearch/src/Product/Search.php
862 /modules/ps_facetedsearch/src/Adapter/MySQL.php
863 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
864 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
865 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
866 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
867 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
868 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
869 /modules/ps_facetedsearch/src/Filters/Products.php
870 /classes/stock/StockAvailable.php
871 /modules/ps_facetedsearch/src/Filters/Block.php
872 /classes/Manufacturer.php
873 /src/Core/Util/String/StringModifier.php
874 /src/Core/Util/String/StringModifierInterface.php
875 /src/Core/Product/Search/Facet.php
876 /src/Core/Product/Search/Filter.php
877 /vendor/prestashop/decimal/src/DecimalNumber.php
878 /vendor/prestashop/decimal/src/Builder.php
879 /src/Core/Product/Search/FacetCollection.php
880 /classes/ProductAssembler.php
881 /classes/tax/Tax.php
882 /classes/SpecificPrice.php
883 /classes/tax/TaxManagerFactory.php
884 /classes/tax/TaxRulesTaxManager.php
885 /classes/tax/TaxManagerInterface.php
886 /classes/tax/TaxCalculator.php
887 /classes/GroupReduction.php
888 /src/Core/Localization/CLDR/ComputingPrecision.php
889 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
890 /classes/Pack.php
891 /classes/order/Order.php
892 /classes/Feature.php
893 /classes/ProductPresenterFactory.php
894 /src/Adapter/Presenter/Product/ProductListingPresenter.php
895 /src/Adapter/Presenter/Product/ProductPresenter.php
896 /src/Adapter/Product/ProductColorsRetriever.php
897 /src/Adapter/HookManager.php
898 /src/Core/Product/ProductPresentationSettings.php
899 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
900 /src/Adapter/Presenter/Product/ProductLazyArray.php
901 /classes/Image.php
902 /src/Core/Image/ImageFormatConfiguration.php
903 /src/Core/Image/ImageFormatConfigurationInterface.php
904 /classes/FeatureFlag.php
905 /src/Core/FeatureFlag/FeatureFlagSettings.php
906 /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
907 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
908 /vendor/smarty/smarty/libs/plugins/modifier.count.php
909 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
911 /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
912 /src/Core/Product/Search/Pagination.php
913 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/a2/ac/10a2acb40a62faa7d4acf2ff79326cb9143364b9_2.file.category.tpl.php
914 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
915 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/7b/44/3b7b442e5be09f725564779ed89a7b73454120cc_2.file.product-list.tpl.php
916 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7b/05/e6/7b05e63eca4eeeca1407af0182fcc5f72eca6296_2.file.layout-left-column.tpl.php
917 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/dd/6f/fedd6f2f1c5383ca8f7a88001e645ec51798686f_2.file.layout-both-columns.tpl.php
918 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9f/7e/4a/9f7e4a2a31953c1ffd9af92c83bd91c1f3cd2c35_2.file.helpers.tpl.php
919 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
920 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/44/bf/b0/44bfb034c1f795379c422b7f1f9e16fbdd438c93_2.file.head.tpl.php
921 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/74/6f/a3/746fa3dd2b21e5f8274bb1f50aedff4595bb552e_2.file.head-jsonld.tpl.php
922 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/8d/80/d08d80bb870efd73dd55124817cbf5d770e7f7b2_2.file.product-list-jsonld.tpl.php
923 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/56/86/bf/5686bf9c07020fd395790a361d8976132a2fc4be_2.file.pagination-seo.tpl.php
924 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
925 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
926 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/93/e8/ed/93e8edeadb416f4f6abcf2d2b76fb0f54d0eba3d_2.file.stylesheets.tpl.php
927 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/af/76/c2af76b01726147ed1ded7543d0fd920339756bf_2.file.javascript.tpl.php
928 /classes/ProductDownload.php
929 /src/Core/Cart/Calculator.php
930 /src/Core/Cart/CartRowCollection.php
931 /src/Core/Cart/Fees.php
932 /src/Core/Cart/AmountImmutable.php
933 /src/Core/Cart/CartRuleCollection.php
934 /src/Core/Cart/CartRuleCalculator.php
935 /src/Adapter/Product/PriceCalculator.php
936 /src/Core/Cart/CartRow.php
937 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
938 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/0d/00/3b0d00bced40dc74d264c896b3629516dca0a06b_2.file.product-activation.tpl.php
939 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/2a/1d/d02a1d5aa2fc8a2b372e76425c1d49b597137881_2.file.header.tpl.php
940 /modules/iqitlinksmanager/iqitlinksmanager.php
941 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
942 /modules/iqitlinksmanager/src/IqitLinkBlock.php
943 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
944 /modules/iqitlinksmanager/translations/es.php
945 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
946 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
947 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
948 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
949 /modules/ps_languageselector/ps_languageselector.php
950 /modules/ps_currencyselector/ps_currencyselector.php
951 /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
952 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/54/66/f65466132945e631eb8304d318e35f83d75d651e_2.file.header-2.tpl.php
953 /modules/iqitsearch/iqitsearch.php
954 /modules/iqitsearch/translations/es.php
955 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
956 /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
957 /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
958 /modules/ps_customersignin/ps_customersignin.php
959 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
960 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
961 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
962 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
963 /var/cache/dev/smarty/compile/warehouse/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
964 /var/cache/dev/smarty/compile/warehouse/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
965 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/a0/a9/c9/a0a9c936f74308bdc1809002e948b8c26b0f5101.iqitmegamenuviewstemplateshookhorizontal.tpl.php
966 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/32/0c/d5/320cd56ae00cdb0df3cfaafda14dd79eef879159_2.file.mobile-header-2.tpl.php
967 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
968 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
969 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
970 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/88/01/f3/8801f3aef6612da9973e6f09844670ad2455b33c_2.file.breadcrumb.tpl.php
971 /modules/iqitproductsnav/iqitproductsnav.php
972 /modules/iqitproductsnav/translations/es.php
973 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/50/cf/2150cf9c7d24917c3322283d8d2a9798a55f33e1_2.file.notifications.tpl.php
974 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/39/dd/35/39dd3579b0d411714a13183f74f90657d9b16218_2.file.category-header.tpl.php
975 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/dc/dd/42/dcdd424ea5bdc2c731edea74e82e1b9752018d7f_2.file.products-top.tpl.php
976 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
977 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/f8/f7/e0f8f73bf2628e2a1784900d2234f9911a72566f_2.file.sort-orders.tpl.php
978 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/01/2d/6a/012d6af2272aef31c4959b70cb660dbba790eea4_2.file.pagination.tpl.php
979 /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
980 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e1/47/0e/e1470e491391572ac54700f0cafe332fed74977f_2.file.products.tpl.php
981 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/df/f3/21dff30aa3f82bc080b677e35ebedc1ec9a53690_2.file.product.tpl.php
982 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b2/b6/ab/b2b6ab658128da2281b45debedef04ba4285e0d8_2.file.product-miniature-1.tpl.php
983 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/70/ad/8b/70ad8bf895d617e9f5f73f4ce8c2c56d5c17c215_2.file.product-miniature-thumb.tpl.php
984 /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
985 /var/cache/dev/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
986 /modules/iqitproductflags/iqitproductflags.php
987 /src/Adapter/ContainerFinder.php
988 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php
989 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php
990 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php
991 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php
992 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php
993 /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php
994 /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php
995 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php
996 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php
997 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php
998 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php
999 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php
1000 /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php
1001 /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php
1002 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php
1003 /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php
1004 /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php
1005 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php
1006 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php
1007 /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php
1008 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php
1009 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php
1010 /vendor/doctrine/persistence/src/Persistence/ObjectManager.php
1011 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php
1012 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php
1013 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php
1014 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php
1015 /vendor/doctrine/doctrine-bundle/ConnectionFactory.php
1016 /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php
1017 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php
1018 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php
1019 /vendor/doctrine/event-manager/src/EventManager.php
1020 /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php
1021 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php
1022 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php
1023 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php
1024 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php
1025 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php
1026 /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php
1027 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php
1028 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php
1029 /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php
1030 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php
1031 /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php
1032 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php
1033 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php
1034 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php
1035 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php
1036 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php
1037 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php
1038 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php
1039 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php
1040 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php
1041 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php
1042 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php
1043 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php
1044 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL80Platform.php
1045 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL57Platform.php
1046 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php
1047 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php
1048 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php
1049 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php
1050 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php
1051 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php
1052 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php
1053 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php
1054 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php
1055 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php
1056 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php
1057 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php
1058 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php
1059 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php
1060 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php
1061 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php
1062 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php
1063 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php
1064 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php
1065 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php
1066 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php
1067 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php
1068 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php
1069 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php
1070 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php
1071 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php
1072 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php
1073 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php
1074 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php
1075 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php
1076 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php
1077 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php
1078 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php
1079 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php
1080 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php
1081 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php
1082 /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php
1083 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php
1084 /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php
1085 /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php
1086 /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php
1087 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php
1088 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php
1089 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php
1090 /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php
1091 /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php
1092 /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php
1093 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php
1094 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php
1095 /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php
1096 /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php
1097 /vendor/doctrine/persistence/src/Persistence/Proxy.php
1098 /modules/iqitproductflags/src/Entity/IqitProductFlag.php
1099 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php
1100 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php
1101 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php
1102 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php
1103 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php
1104 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php
1105 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php
1106 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php
1107 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php
1108 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php
1109 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php
1110 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php
1111 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php
1112 /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php
1113 /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php
1114 /src/PrestaShopBundle/Entity/Shop.php
1115 /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php
1116 /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php
1117 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php
1118 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php
1119 /modules/iqitproductflags/src/Repository/FlagRepository.php
1120 /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php
1121 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php
1122 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php
1123 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php
1124 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php
1125 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php
1126 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php
1127 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php
1128 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php
1129 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php
1130 /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php
1131 /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php
1132 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php
1133 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php
1134 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php
1135 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php
1136 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php
1137 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php
1138 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php
1139 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php
1140 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php
1141 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php
1142 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php
1143 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php
1144 /src/PrestaShopBundle/Entity/Lang.php
1145 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php
1146 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php
1147 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php
1148 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php
1149 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php
1150 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php
1151 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php
1152 /src/PrestaShopBundle/Entity/ShopGroup.php
1153 /src/PrestaShopBundle/Entity/ShopUrl.php
1154 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php
1155 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php
1156 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php
1157 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php
1158 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php
1159 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php
1160 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php
1161 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php
1162 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php
1163 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php
1164 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php
1165 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php
1166 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php
1167 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php
1168 /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php
1169 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php
1170 /src/PrestaShopBundle/Entity/Translation.php
1171 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php
1172 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php
1173 /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php
1174 /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php
1175 /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php
1176 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php
1177 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php
1178 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php
1179 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php
1180 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php
1181 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php
1182 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php
1183 /modules/iqitproductflags/src/Presenter/FlagPresenter.php
1184 /var/cache/dev/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php
1185 /var/cache/dev/smarty/compile/warehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1186 /vendor/smarty/smarty/libs/plugins/function.math.php
1187 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/75/b9/97/75b997bec85704ff1d7a8fb47417253a50e7be32_2.file.product-miniature-btn.tpl.php
1188 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/50/d2/88/50d288732d70e59ef94f3875a561157d73c09f9e_2.file.products-bottom.tpl.php
1189 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/ce/84/ea/ce84eadc655e6b98707bc940129b94e0b7569370_2.file.category-footer.tpl.php
1190 /modules/ps_categorytree/ps_categorytree.php
1191 /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1192 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/3a/47/3e3a47dc2c5a5d8e5e109d269aa58f1349bf3548_2.file.footer.tpl.php
1193 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e6/9f/81/e69f8156b2319dff0e9edb2994d7f3cbefe774c5_2.file.footer-2.tpl.php
1194 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1195 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/6/warehouse/1d/83/01/1d8301bd7699d773c48e9ed487e5b638a51c9c67.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1196 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/00/82/b5/0082b5f5ed9b849deb993e6b9ea0688ca3375d26_2.file.footer-copyrights-1.tpl.php
1197 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e7/73/6b/e7736b26e5e94f428f828dbc3573ce171a95c436_2.file.password-policy-template.tpl.php
1198 /classes/form/CustomerLoginForm.php
1199 /classes/form/AbstractForm.php
1200 /classes/form/FormInterface.php
1201 /src/Core/Foundation/Templating/RenderableInterface.php
1202 /classes/form/CustomerLoginFormatter.php
1203 /classes/form/FormFormatterInterface.php
1204 /classes/ValidateConstraintTranslator.php
1205 /src/Core/Util/InternationalizedDomainNameConverter.php
1206 /src/Core/Foundation/Templating/RenderableProxy.php
1207 /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1208 /classes/form/FormField.php
1209 /var/cache/dev/smarty/compile/warehouse/f2/1e/55/f21e55894ac1dca3333e5ff490219e193d3a69c6_2.file.login-form.tpl.php
1210 /var/cache/dev/smarty/compile/warehouse/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1211 /var/cache/dev/smarty/compile/d2/95/88/d29588162f18c1514f5b17d42ceef7eee6820be1_2.file.form-fields.tpl.php
1212 /var/cache/dev/smarty/compile/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1213 /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/6/warehouse/60/1e/f4/601ef4a2f7dca2c97f8f1a899dc64be4a2331ab8.iqitsocialloginviewstemplateshookauthentication.tpl.php
1214 /var/cache/dev/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1215 /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/02/05/98/020598f14f8b3a756a608f01492a41ebd60e5afd.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1216 /modules/statsdata/statsdata.php
1217 /classes/Connection.php
1218 /classes/ConnectionsSource.php
1219 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1220 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1221 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1222 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1223 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1224 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1225 /var/cache/dev/smarty/compile/warehouse/0b/04/d5/0b04d5d296cc40e94fc50a82355434090632a0d7_2.file.ga_tag.tpl.php