FACIAL

Cosmética facial 

Cuida tu piel con nuestra dermocosmética facial

Mostrando 1-36 de 81 artículo(s)
Producto añadido
Producto añadido a Comparar

Este sitio web utiliza cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Para dar su consentimiento sobre su uso pulse el botón Acepto.

Load Time 738.637 ms
Querying Time 309 ms
Queries 754
Memory Peak Usage 65.1 Mb
Included Files 1231 files - 12.71 Mb
PrestaShop Cache - Mb
Global vars 0.05 Mb
PrestaShop Version 8.2.7
PHP Version 8.4.10
MySQL Version 8.0.45-36
Memory Limit 512M
Max Execution Time 165s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 99.012 ms 99.012 ms 18.40 Mb 19.6 Mb
__construct 0.013 ms 99.025 ms - Mb 19.6 Mb
init 40.000 ms 139.025 ms 5.29 Mb 24.7 Mb
checkAccess 0.002 ms 139.027 ms - Mb 24.7 Mb
setMedia 3.967 ms 142.994 ms 0.79 Mb 24.7 Mb
postProcess 0.002 ms 142.996 ms - Mb 24.7 Mb
initHeader 0.001 ms 142.997 ms - Mb 24.7 Mb
initContent 380.901 ms 523.898 ms 24.08 Mb 48.6 Mb
initFooter 0.003 ms 523.901 ms - Mb 48.6 Mb
display 214.736 ms 738.637 ms 15.40 Mb 65.1 Mb
Hook Time Memory Usage
DisplayProductCampagains 90.070 ms 6.61 Mb
displayProductListReviews 21.458 ms 1.40 Mb
displayProductListFunctionalButtons 13.830 ms 0.09 Mb
displayBeforeBodyClosingTag 6.701 ms 0.82 Mb
DisplayBeforeBodyClosingTag 6.641 ms 0.32 Mb
displayLeftColumn 3.960 ms 0.29 Mb
DisplayHeader 3.162 ms 0.18 Mb
displayNav1 3.060 ms 0.26 Mb
displayNav2 2.851 ms 0.18 Mb
renderWidget 2.361 ms 0.21 Mb
ProductSearchProvider 1.932 ms 0.20 Mb
displayMainMenu 1.266 ms 0.20 Mb
displayCategoryElementor 1.235 ms 0.08 Mb
displayFooter 1.230 ms 0.10 Mb
displayCustomerLoginFormAfter 1.004 ms 0.07 Mb
ActionFrontControllerSetMedia 0.708 ms 0.13 Mb
displayAfterBreadcrumb 0.684 ms 0.04 Mb
IsJustElementor 0.439 ms 0.02 Mb
DisplayLeftColumn 0.328 ms 0.08 Mb
OverrideLayoutTemplate 0.044 ms - Mb
displayVerticalMenu 0.009 ms - Mb
ModuleRoutes 0.007 ms - Mb
ActionProductSearchAfter 0.006 ms - Mb
ActionDispatcher 0.005 ms - Mb
24 hook(s) 162.992 ms 11.28 Mb
Module Time Memory Usage
ph_simpleblog 14.587 ms 3.30 Mb
iqitthemeeditor 1.939 ms 0.54 Mb
ps_emailsubscription 1.918 ms 0.37 Mb
ps_emailalerts 1.255 ms 0.29 Mb
iqitproductvariants 0.332 ms 0.04 Mb
revsliderprestashop 38.515 ms 7.98 Mb
productcomments 1.538 ms 0.28 Mb
ps_shoppingcart 0.402 ms 0.05 Mb
iqitcontactpage 1.407 ms 0.12 Mb
iqitcookielaw 1.359 ms 0.11 Mb
iqitcountdown 0.309 ms 0.03 Mb
iqitsociallogin 1.629 ms 0.14 Mb
ps_googleanalytics 4.894 ms 0.35 Mb
iqitsizecharts 1.305 ms 0.26 Mb
iqitwishlist 14.328 ms 0.95 Mb
iqitreviews 22.180 ms 1.51 Mb
iqitpopup 1.372 ms 0.15 Mb
iqitmegamenu 6.269 ms 1.06 Mb
iqitcompare 7.567 ms 0.16 Mb
iqitelementor 7.344 ms 1.07 Mb
iqitextendedproduct 1.017 ms 0.16 Mb
iqitfreedeliverycount 0.419 ms 0.06 Mb
ps_facetedsearch 7.017 ms 0.92 Mb
iqitlinksmanager 3.493 ms 0.38 Mb
iqithtmlandbanners 1.767 ms 0.16 Mb
ps_languageselector 0.861 ms 0.07 Mb
ps_currencyselector 0.920 ms 0.08 Mb
iqitsearch 1.609 ms 0.12 Mb
ps_customersignin 0.176 ms 0.03 Mb
iqitproductsnav 1.007 ms 0.07 Mb
iqitproductflags 90.606 ms 6.74 Mb
ps_categorytree 4.475 ms 0.36 Mb
statsdata 3.625 ms 0.17 Mb
33 module(s) 247.443 ms 28.08 Mb

Stopwatch SQL - 754 queries

# Query Time (ms) Rows Filesort Group By Location
83
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p GROUP BY p.id_manufacturer
12.749 ms 39950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
91
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 6) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-06-22 20:17:04' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-06-22 20:17:04' <= sp.to) 
) WHERE ((sp.reduction>0))
5.707 ms 504 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
89
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE ((p.on_sale=1))
5.012 ms 504 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
90
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE p.date_add>'2026-06-03 00:00:00'
4.930 ms 504 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
92
REPLACE INTO och438layered_filter_block (hash, data) VALUES ("be545d6b0364ef057e83e8b467001d10", "a:1:{s:7:\"filters\";a:4:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:12:{i:26;a:2:{s:4:\"name\";s:11:\"LIMPIADORES\";s:3:\"nbr\";s:2:\"10\";}i:29;a:2:{s:4:\"name\";s:5:\"SERUM\";s:3:\"nbr\";s:2:\"23\";}i:33;a:2:{s:4:\"name\";s:16:\"CONTORNO DE OJOS\";s:3:\"nbr\";s:1:\"6\";}i:40;a:2:{s:4:\"name\";s:11:\"EXFOLIANTES\";s:3:\"nbr\";s:1:\"5\";}i:41;a:2:{s:4:\"name\";s:11:\"MASCARILLAS\";s:3:\"nbr\";s:1:\"4\";}i:42;a:2:{s:4:\"name\";s:8:\"TÓNICOS\";s:3:\"nbr\";s:1:\"2\";}i:43;a:2:{s:4:\"name\";s:8:\"AMPOLLAS\";s:3:\"nbr\";s:1:\"7\";}i:44;a:2:{s:4:\"name\";s:6:\"CREMAS\";s:3:\"nbr\";s:2:\"14\";}i:130;a:2:{s:4:\"name\";s:17:\"COSMETICA COREANA\";s:3:\"nbr\";s:1:\"4\";}i:131;a:2:{s:4:\"name\";s:16:\"POTENCIA TU GLOW\";s:3:\"nbr\";s:2:\"12\";}i:138;a:2:{s:4:\"name\";s:7:\"MANCHAS\";s:3:\"nbr\";s:1:\"7\";}i:275;a:2:{s:4:\"name\";s:12:\"DESODORANTES\";s:3:\"nbr\";s:1:\"1\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:38:{i:3;a:2:{s:4:\"name\";s:5:\"ISDIN\";s:3:\"nbr\";s:1:\"8\";}i:5;a:2:{s:4:\"name\";s:14:\"Cantabria Labs\";s:3:\"nbr\";s:1:\"1\";}i:6;a:2:{s:4:\"name\";s:6:\"Cerave\";s:3:\"nbr\";s:2:\"22\";}i:7;a:2:{s:4:\"name\";s:3:\"SVR\";s:3:\"nbr\";s:1:\"1\";}i:11;a:2:{s:4:\"name\";s:14:\"LA ROCHE POSAY\";s:3:\"nbr\";s:2:\"19\";}i:12;a:3:{s:4:\"name\";s:11:\"IFCANTABRIA\";s:3:\"nbr\";s:2:\"54\";s:7:\"checked\";b:1;}i:13;a:2:{s:4:\"name\";s:15:\"LAB SVR ESPAÑA\";s:3:\"nbr\";s:2:\"68\";}i:14;a:2:{s:4:\"name\";s:13:\"SKINCEUTICALS\";s:3:\"nbr\";s:2:\"32\";}i:22;a:2:{s:4:\"name\";s:18:\"LETI PHARMA S.L.U.\";s:3:\"nbr\";s:1:\"3\";}i:57;a:3:{s:4:\"name\";s:11:\"ARTURO ALBA\";s:3:\"nbr\";s:2:\"23\";s:7:\"checked\";b:1;}i:58;a:2:{s:4:\"name\";s:8:\"ERBORIAN\";s:3:\"nbr\";s:2:\"20\";}i:59;a:2:{s:4:\"name\";s:13:\"Moncho moreno\";s:3:\"nbr\";s:1:\"1\";}i:61;a:2:{s:4:\"name\";s:3:\"TWO\";s:3:\"nbr\";s:2:\"20\";}i:62;a:2:{s:4:\"name\";s:15:\"IVB Welness lab\";s:3:\"nbr\";s:1:\"1\";}i:67;a:2:{s:4:\"name\";s:22:\"L´occitane (erborian)\";s:3:\"nbr\";s:2:\"58\";}i:68;a:2:{s:4:\"name\";s:18:\"GEMA HERRERIA S.LU\";s:3:\"nbr\";s:2:\"33\";}i:70;a:2:{s:4:\"name\";s:19:\"MIIN COSMETICS S.L.\";s:3:\"nbr\";s:2:\"11\";}i:87;a:2:{s:4:\"name\";s:7:\"OZOAQUA\";s:3:\"nbr\";s:1:\"1\";}i:93;a:2:{s:4:\"name\";s:16:\"BEAUTY OF JOSEON\";s:3:\"nbr\";s:2:\"24\";}i:94;a:2:{s:4:\"name\";s:6:\"TOCOBO\";s:3:\"nbr\";s:1:\"9\";}i:99;a:2:{s:4:\"name\";s:6:\"BIODES\";s:3:\"nbr\";s:1:\"5\";}i:100;a:2:{s:4:\"name\";s:12:\"CANTABRIA PH\";s:3:\"nbr\";s:1:\"3\";}i:112;a:2:{s:4:\"name\";s:6:\"d\'Alba\";s:3:\"nbr\";s:1:\"6\";}i:113;a:2:{s:4:\"name\";s:15:\"haruharu wonder\";s:3:\"nbr\";s:1:\"2\";}i:114;a:2:{s:4:\"name\";s:8:\"Dr.Jart+\";s:3:\"nbr\";s:1:\"3\";}i:115;a:2:{s:4:\"name\";s:8:\"MEDICUBE\";s:3:\"nbr\";s:2:\"23\";}i:116;a:2:{s:4:\"name\";s:32:\"ESPAÑOLA DE NUEVOS TRATAMIENTOS\";s:3:\"nbr\";s:1:\"6\";}i:117;a:2:{s:4:\"name\";s:6:\"MISSHA\";s:3:\"nbr\";s:1:\"5\";}i:119;a:2:{s:4:\"name\";s:6:\"TIRTIR\";s:3:\"nbr\";s:1:\"6\";}i:120;a:2:{s:4:\"name\";s:10:\"Dr. Althea\";s:3:\"nbr\";s:1:\"1\";}i:121;a:2:{s:4:\"name\";s:13:\"UNICSKIN S.L.\";s:3:\"nbr\";s:1:\"2\";}i:122;a:2:{s:4:\"name\";s:19:\"ALTA COMESTICA S.L.\";s:3:\"nbr\";s:1:\"1\";}i:123;a:2:{s:4:\"name\";s:4:\"FIMO\";s:3:\"nbr\";s:1:\"1\";}i:124;a:2:{s:4:\"name\";s:42:\"ASOCIACION ESPAÑOLA DE PKAN ISBEL HEREDIA\";s:3:\"nbr\";s:1:\"1\";}i:125;a:2:{s:4:\"name\";s:4:\"ANUA\";s:3:\"nbr\";s:1:\"4\";}i:126;a:3:{s:4:\"name\";s:12:\"VT COSMETICS\";s:3:\"nbr\";s:1:\"3\";s:7:\"checked\";b:1;}i:127;a:3:{s:4:\"name\";s:12:\"BIOCOSMETICS\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:128;a:2:{s:4:\"name\";s:8:\"ASIN FCA\";s:3:\"nbr\";s:1:\"2\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:95;s:3:\"min\";d:5;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:81;s:5:\"value\";N;}i:3;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Selecciones\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:9:\"En oferta\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:5:\"Nuevo\";s:3:\"nbr\";i:2;}s:8:\"discount\";a:2:{s:4:\"name\";s:13:\"Con descuento\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
3.958 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:210
84
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM och438product p INNER JOIN och438layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 6) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40
2.789 ms 252 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `och438configuration` c
LEFT JOIN `och438configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
2.773 ms 1327 /classes/Configuration.php:180
109
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `och438hook_module` hm
STRAIGHT_JOIN `och438hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `och438module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.699 ms 524 /classes/Hook.php:455
72
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
2.407 ms 1008 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
75
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=3 AND c.nleft>7 AND c.nright<40 GROUP BY cp.id_category
2.245 ms 1008 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
751
INSERT INTO `och438connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('200453', '', 'farmacialanueva.online/22-facial?q=Marca-ARTURO+ALBA-BIOCOSMETICS-VT+COSMETICS-IFCANTABRIA&resultsPerPage=36', '', '2026-06-22 20:17:04')
2.030 ms 1 /classes/ObjectModel.php:622
108
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `och438hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `och438hook_alias` ha
INNER JOIN `och438hook` h ON ha.name = h.name
1.983 ms 0 /classes/Hook.php:1348
93
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-06-22 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM och438product p
LEFT JOIN och438product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN och438stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN och438product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (701,1314,747,749,770,783,1814,2662,1620,2473,1308,2434,1313,1494,1310,2474,1485,2521,1304,1316,1305,1306,1307,1233,1538,1506,1186,1187,1607,1537,1543,1608,1496,1521,1556,1486)
1.744 ms 36 /classes/ProductAssembler.php:95
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `och438module` m
INNER JOIN och438module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `och438hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `och438hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `och438module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.240 ms 1560 Yes Yes /classes/Hook.php:1289
88
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute
1.213 ms 504 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
86
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute
1.196 ms 504 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
753
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `och438category_product` cp
LEFT JOIN `och438category` c ON (c.id_category = cp.id_category)
LEFT JOIN `och438category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (701,1314,747,749,770,783,1814,2662,1620,2473,1308,2434,1313,1494,1310,2474,1485,2521,1304,1316,1305,1306,1307,1233,1538,1506,1186,1187,1607,1537,1543,1608,1496,1521,1556,1486) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
1.086 ms 2745 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:103
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `och438hook` h
WHERE (h.active = 1)
0.919 ms 1143 /classes/Hook.php:1388
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook`
0.726 ms 1143 /classes/Hook.php:1348
85
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC
0.721 ms 3 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
69
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.706 ms 129 Yes /classes/Manufacturer.php:201
87
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC
0.696 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
736
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `och438category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `och438category` c2 ON c2.`id_category` = 22 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 6 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
0.678 ms 61 Yes Yes /classes/Category.php:785
82
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.672 ms 129 Yes /classes/Manufacturer.php:201
77
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute
0.654 ms 504 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
325
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1305 LIMIT 1
0.640 ms 1 /classes/SpecificPrice.php:435
79
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute
0.635 ms 504 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
147
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 749 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.627 ms 1 Yes /classes/SpecificPrice.php:576
80
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value
0.611 ms 504 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
37
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `och438category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 22
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.590 ms 61 Yes Yes /classes/Category.php:916
166
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 783
AND image_shop.`cover` = 1 LIMIT 1
0.585 ms 1 /classes/Product.php:3570
81
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (57, 127, 12, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value
0.571 ms 504 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
590
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1556) AND (b.`id_shop` = 1) LIMIT 1
0.549 ms 1 /src/Adapter/EntityMapper.php:71
101
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `och438specific_price` WHERE `id_product` != 0
0.541 ms 521 /classes/SpecificPrice.php:310
78
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC
0.540 ms 14 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
170
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 783 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.538 ms 1 Yes /classes/SpecificPrice.php:576
67
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `och438attribute_group` ag  INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `och438layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
0.538 ms 4 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122
76
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC
0.529 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
132
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 747) AND (b.`id_shop` = 1) LIMIT 1
0.523 ms 1 /src/Adapter/EntityMapper.php:71
110
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.523 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:100
135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 747 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.521 ms 1 Yes /classes/SpecificPrice.php:576
94
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 701
AND image_shop.`cover` = 1 LIMIT 1
0.521 ms 1 /classes/Product.php:3570
105
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 701 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.517 ms 1 Yes /classes/SpecificPrice.php:576
68
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `och438feature` f  INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `och438feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `och438layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.516 ms 6 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:159
363
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1538 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.514 ms 1 Yes /classes/SpecificPrice.php:576
298
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.507 ms 1 Yes /classes/SpecificPrice.php:576
437
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.506 ms 0 /classes/Cart.php:1430
548
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1304) AND (b.`id_shop` = 1) LIMIT 1
0.505 ms 1 /src/Adapter/EntityMapper.php:71
581
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1543) AND (b.`id_shop` = 1) LIMIT 1
0.504 ms 1 /src/Adapter/EntityMapper.php:71
491
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1486 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.503 ms 1 Yes /classes/SpecificPrice.php:576
557
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1306) AND (b.`id_shop` = 1) LIMIT 1
0.498 ms 1 /src/Adapter/EntityMapper.php:71
255
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1494 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.497 ms 1 Yes /classes/SpecificPrice.php:576
484
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1556 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1556 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.497 ms 0 /classes/Cart.php:1430
74
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.496 ms 61 Yes /classes/Category.php:710
386
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1186 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.495 ms 1 Yes /classes/SpecificPrice.php:576
303
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.491 ms 0 /classes/Cart.php:1430
554
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1305) AND (b.`id_shop` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
566
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1538) AND (b.`id_shop` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
397
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1187 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.486 ms 1 Yes /classes/SpecificPrice.php:576
97
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 12
AND `active` = 1 LIMIT 1
0.485 ms 1 /classes/Manufacturer.php:312
571
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1186) AND (b.`id_shop` = 1) LIMIT 1
0.483 ms 1 /src/Adapter/EntityMapper.php:71
426
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1537 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1537 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.482 ms 0 /classes/Cart.php:1430
563
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1233) AND (b.`id_shop` = 1) LIMIT 1
0.482 ms 1 /src/Adapter/EntityMapper.php:71
574
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1187) AND (b.`id_shop` = 1) LIMIT 1
0.482 ms 1 /src/Adapter/EntityMapper.php:71
275
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2474 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.481 ms 1 Yes /classes/SpecificPrice.php:576
287
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1485 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.480 ms 1 Yes /classes/SpecificPrice.php:576
444
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1608 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.478 ms 1 Yes /classes/SpecificPrice.php:576
468
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.478 ms 1 Yes /classes/SpecificPrice.php:576
432
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1543 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.477 ms 1 Yes /classes/SpecificPrice.php:576
551
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1316) AND (b.`id_shop` = 1) LIMIT 1
0.474 ms 1 /src/Adapter/EntityMapper.php:71
560
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1307) AND (b.`id_shop` = 1) LIMIT 1
0.474 ms 1 /src/Adapter/EntityMapper.php:71
625
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (701) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.471 ms 1 Yes Yes /classes/Product.php:4513
375
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1506 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.467 ms 1 Yes /classes/SpecificPrice.php:576
421
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1537 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.464 ms 1 Yes /classes/SpecificPrice.php:576
128
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1314 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1314 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.463 ms 0 /classes/Cart.php:1430
409
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1607 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.462 ms 1 Yes /classes/SpecificPrice.php:576
479
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1556 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.462 ms 1 Yes /classes/SpecificPrice.php:576
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `och438meta` m
LEFT JOIN `och438meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.461 ms 57 Yes /classes/Dispatcher.php:654
181
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1814)
0.461 ms 1 /classes/Product.php:3860
117
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 701 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 701 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.457 ms 0 /classes/Cart.php:1430
204
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1620 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.455 ms 1 Yes /classes/SpecificPrice.php:576
215
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2473 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.455 ms 1 Yes /classes/SpecificPrice.php:576
496
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1486 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1486 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.455 ms 0 /classes/Cart.php:1430
545
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2521) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
159
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 770 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.451 ms 1 Yes /classes/SpecificPrice.php:576
292
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1485 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1485 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.450 ms 0 /classes/Cart.php:1430
330
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1305 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.449 ms 0 /classes/Cart.php:1430
260
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1494 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1494 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.448 ms 0 /classes/Cart.php:1430
402
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1187 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1187 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.448 ms 0 /classes/Cart.php:1430
414
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1607 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1607 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.448 ms 0 /classes/Cart.php:1430
456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1496 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.448 ms 1 Yes /classes/SpecificPrice.php:576
498
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 701) AND (b.`id_shop` = 1) LIMIT 1
0.447 ms 1 /src/Adapter/EntityMapper.php:71
461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1496 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1496 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.445 ms 0 /classes/Cart.php:1430
503
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1314) AND (b.`id_shop` = 1) LIMIT 1
0.444 ms 1 /src/Adapter/EntityMapper.php:71
441
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1608) AND (b.`id_shop` = 1) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
391
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1186 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1186 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.441 ms 0 /classes/Cart.php:1430
368
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1538 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1538 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.440 ms 0 /classes/Cart.php:1430
406
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1607) AND (b.`id_shop` = 1) LIMIT 1
0.440 ms 1 /src/Adapter/EntityMapper.php:71
175
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 783 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 783 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.439 ms 0 /classes/Cart.php:1430
66
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM och438layered_category
WHERE controller = 'category'
AND id_category = 22
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.436 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
312
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1304 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.436 ms 0 /classes/Cart.php:1430
102
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `from` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.435 ms 1 /classes/SpecificPrice.php:377
512
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 783) AND (b.`id_shop` = 1) LIMIT 1
0.433 ms 1 /src/Adapter/EntityMapper.php:71
321
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1316 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1316 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.433 ms 0 /classes/Cart.php:1430
22
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.432 ms 104 /classes/module/Module.php:341
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 747 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 747 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.432 ms 0 /classes/Cart.php:1430
112
SELECT SQL_NO_CACHE *
FROM `och438tax_lang`
WHERE `id_tax` = 31
0.431 ms 1 /src/Adapter/EntityMapper.php:79
130
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 747
AND image_shop.`cover` = 1 LIMIT 1
0.430 ms 1 /classes/Product.php:3570
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 749
AND image_shop.`cover` = 1 LIMIT 1
0.430 ms 1 /classes/Product.php:3570
488
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1486) AND (b.`id_shop` = 1) LIMIT 1
0.430 ms 1 /src/Adapter/EntityMapper.php:71
248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1313 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1313 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.429 ms 0 /classes/Cart.php:1430
380
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1506 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1506 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.429 ms 0 /classes/Cart.php:1430
116
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 701) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.428 ms 1 /classes/stock/StockAvailable.php:453
403
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1187
ORDER BY f.position ASC
0.428 ms 1 Yes /classes/Product.php:6024
209
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1620 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1620 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.427 ms 0 /classes/Cart.php:1430
449
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1608 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1608 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.426 ms 0 /classes/Cart.php:1430
597
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.424 ms 13 /classes/CartRule.php:357
196
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2662 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2662 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.424 ms 0 /classes/Cart.php:1430
357
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1233 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1233 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
518
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2662) AND (b.`id_shop` = 1) LIMIT 1
0.423 ms 1 /src/Adapter/EntityMapper.php:71
185
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1814 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1814 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.422 ms 0 /classes/Cart.php:1430
473
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.420 ms 0 /classes/Cart.php:1430
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.420 ms 104 /classes/module/Module.php:341
280
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2474 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2474 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.420 ms 0 /classes/Cart.php:1430
229
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1308 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1308 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.419 ms 0 /classes/Cart.php:1430
239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2434 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2434 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.419 ms 0 /classes/Cart.php:1430
348
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1307 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.419 ms 0 /classes/Cart.php:1430
62
SELECT SQL_NO_CACHE *
FROM `och438category` a0
LEFT JOIN `och438category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 7) AND (a0.`nright` > 40) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.418 ms 4 /classes/PrestaShopCollection.php:383
339
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1306 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.417 ms 0 /classes/Cart.php:1430
537
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1310) AND (b.`id_shop` = 1) LIMIT 1
0.417 ms 1 /src/Adapter/EntityMapper.php:71
119
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1314
AND image_shop.`cover` = 1 LIMIT 1
0.415 ms 1 /classes/Product.php:3570
269
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1310 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1310 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.414 ms 0 /classes/Cart.php:1430
453
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1496) AND (b.`id_shop` = 1) LIMIT 1
0.414 ms 1 /src/Adapter/EntityMapper.php:71
164
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 770 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 770 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.412 ms 0 /classes/Cart.php:1430
646
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2662) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.412 ms 1 Yes Yes /classes/Product.php:4513
144
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 749) AND (b.`id_shop` = 1) LIMIT 1
0.411 ms 1 /src/Adapter/EntityMapper.php:71
372
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1506) AND (b.`id_shop` = 1) LIMIT 1
0.410 ms 1 /src/Adapter/EntityMapper.php:71
252
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1494) AND (b.`id_shop` = 1) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
540
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2474) AND (b.`id_shop` = 1) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
201
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1620) AND (b.`id_shop` = 1) LIMIT 1
0.408 ms 1 /src/Adapter/EntityMapper.php:71
515
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1814) AND (b.`id_shop` = 1) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
523
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2473) AND (b.`id_shop` = 1) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
628
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1314) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.406 ms 1 Yes Yes /classes/Product.php:4513
156
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 770) AND (b.`id_shop` = 1) LIMIT 1
0.405 ms 1 /src/Adapter/EntityMapper.php:71
152
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 749 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 749 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.403 ms 0 /classes/Cart.php:1430
111
SELECT SQL_NO_CACHE *
FROM `och438tax` a
WHERE (a.`id_tax` = 31) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
220
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2473 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2473 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.402 ms 0 /classes/Cart.php:1430
465
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1521) AND (b.`id_shop` = 1) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
676
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.402 ms 1 Yes Yes /classes/Product.php:4513
691
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1307) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.402 ms 1 Yes Yes /classes/Product.php:4513
730
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1486) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.402 ms 1 Yes Yes /classes/Product.php:4513
658
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2434) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.401 ms 1 Yes Yes /classes/Product.php:4513
661
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1313) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.401 ms 1 Yes Yes /classes/Product.php:4513
631
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (747) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.401 ms 1 Yes Yes /classes/Product.php:4513
634
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (749) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.400 ms 1 Yes Yes /classes/Product.php:4513
682
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1316) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.400 ms 1 Yes Yes /classes/Product.php:4513
673
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1485) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.400 ms 1 Yes Yes /classes/Product.php:4513
418
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1537) AND (b.`id_shop` = 1) LIMIT 1
0.399 ms 1 /src/Adapter/EntityMapper.php:71
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM och438shop_group gs
LEFT JOIN och438shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN och438shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.398 ms 1 Yes /classes/shop/Shop.php:715
284
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1485) AND (b.`id_shop` = 1) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
304
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2521
ORDER BY f.position ASC
0.396 ms 1 Yes /classes/Product.php:6024
596
SELECT SQL_NO_CACHE 1 FROM och438cart_product cp INNER JOIN och438product p
ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.395 ms 1 /classes/Cart.php:4250
180
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1814 LIMIT 1
0.394 ms 1 /classes/SpecificPrice.php:435
529
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2434) AND (b.`id_shop` = 1) LIMIT 1
0.393 ms 1 /src/Adapter/EntityMapper.php:71
133
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 747 LIMIT 1
0.393 ms 1 /classes/SpecificPrice.php:435
532
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1313) AND (b.`id_shop` = 1) LIMIT 1
0.392 ms 1 /src/Adapter/EntityMapper.php:71
637
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (770) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.392 ms 1 Yes Yes /classes/Product.php:4513
708
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1607 LIMIT 1
0.392 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
438
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1543
ORDER BY f.position ASC
0.391 ms 1 Yes /classes/Product.php:6024
640
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (783) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.390 ms 1 Yes Yes /classes/Product.php:4513
649
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1620) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.389 ms 1 Yes Yes /classes/Product.php:4513
98
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 0 LIMIT 1
0.388 ms 1 /classes/SpecificPrice.php:426
643
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1814) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.388 ms 1 Yes Yes /classes/Product.php:4513
721
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1496) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.388 ms 1 Yes Yes /classes/Product.php:4513
153
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 749
ORDER BY f.position ASC
0.387 ms 1 Yes /classes/Product.php:6024
688
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1306) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.387 ms 1 Yes Yes /classes/Product.php:4513
694
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1233) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.387 ms 1 Yes Yes /classes/Product.php:4513
724
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.387 ms 1 Yes Yes /classes/Product.php:4513
427
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1537
ORDER BY f.position ASC
0.386 ms 1 Yes /classes/Product.php:6024
497
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1486
ORDER BY f.position ASC
0.386 ms 1 Yes /classes/Product.php:6024
679
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1304) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.385 ms 1 Yes Yes /classes/Product.php:4513
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM och438shop_url su
LEFT JOIN och438shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'farmacialanueva.online' OR su.domain_ssl = 'farmacialanueva.online')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.384 ms 1 Yes /classes/shop/Shop.php:1364
670
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2474) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.384 ms 1 Yes Yes /classes/Product.php:4513
664
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1494) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.383 ms 1 Yes Yes /classes/Product.php:4513
700
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1506) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.382 ms 1 Yes Yes /classes/Product.php:4513
718
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1608) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.382 ms 1 Yes Yes /classes/Product.php:4513
652
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2473) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.381 ms 1 Yes Yes /classes/Product.php:4513
655
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1308) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.381 ms 1 Yes Yes /classes/Product.php:4513
107
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 701 AND id_shop=1 LIMIT 1
0.380 ms 1 /classes/Product.php:6884
750
SELECT SQL_NO_CACHE `id_guest`
FROM `och438connections`
WHERE `id_guest` = 200887
AND `date_add` > '2026-06-22 19:47:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.380 ms 1 Yes /classes/Connection.php:168
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `och438lang` l
JOIN och438lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.379 ms 1 /classes/Language.php:1214
584
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1608
ORDER BY `position`
0.378 ms 1 Yes /classes/Product.php:3539
118
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 701
ORDER BY f.position ASC
0.376 ms 1 Yes /classes/Product.php:6024
526
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1308) AND (b.`id_shop` = 1) LIMIT 1
0.376 ms 1 /src/Adapter/EntityMapper.php:71
598
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.376 ms 13 /classes/CartRule.php:357
709
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1607) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.376 ms 1 Yes Yes /classes/Product.php:4513
712
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1537) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.376 ms 1 Yes Yes /classes/Product.php:4513
727
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1556) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.376 ms 1 Yes Yes /classes/Product.php:4513
17
SELECT SQL_NO_CACHE value FROM `och438configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.375 ms 1 /classes/shop/Shop.php:1183
145
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 749 LIMIT 1
0.375 ms 1 /classes/SpecificPrice.php:435
647
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1620
0.375 ms 2 /classes/Product.php:3420
685
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1305) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.375 ms 1 Yes Yes /classes/Product.php:4513
293
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1485
ORDER BY f.position ASC
0.374 ms 1 Yes /classes/Product.php:6024
667
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1310) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.374 ms 1 Yes Yes /classes/Product.php:4513
415
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1607
ORDER BY f.position ASC
0.373 ms 1 Yes /classes/Product.php:6024
686
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1306
0.373 ms 2 /classes/Product.php:3420
703
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1186) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.371 ms 1 Yes Yes /classes/Product.php:4513
35
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.371 ms 1 /classes/Category.php:2446
299
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2521)
0.371 ms 1 /classes/Product.php:3860
19
SELECT SQL_NO_CACHE name, alias FROM `och438hook_alias`
0.370 ms 88 /classes/Hook.php:342
249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1313
ORDER BY f.position ASC
0.370 ms 1 Yes /classes/Product.php:6024
305
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1304
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 1 /classes/Product.php:3570
622
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitreviews" LIMIT 1
0.370 ms 1 /classes/module/Module.php:2664
23
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) AND (b.`id_shop` = 1) LIMIT 1
0.369 ms 1 /src/Adapter/EntityMapper.php:71
127
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1314) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:453
614
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `och438cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.369 ms 1 /classes/Cart.php:1300
697
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1538) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.369 ms 1 Yes Yes /classes/Product.php:4513
129
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1314
ORDER BY f.position ASC
0.369 ms 1 Yes /classes/Product.php:6024
392
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1186
ORDER BY f.position ASC
0.369 ms 1 Yes /classes/Product.php:6024
358
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1233
ORDER BY f.position ASC
0.368 ms 1 Yes /classes/Product.php:6024
485
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1556
ORDER BY f.position ASC
0.368 ms 1 Yes /classes/Product.php:6024
626
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1314
0.366 ms 3 /classes/Product.php:3420
221
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2473
ORDER BY f.position ASC
0.365 ms 1 Yes /classes/Product.php:6024
521
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1620
ORDER BY `position`
0.365 ms 1 Yes /classes/Product.php:3539
172
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 783 AND id_shop=1 LIMIT 1
0.364 ms 1 /classes/Product.php:6884
261
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1494
ORDER BY f.position ASC
0.364 ms 1 Yes /classes/Product.php:6024
340
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1306
ORDER BY f.position ASC
0.364 ms 1 Yes /classes/Product.php:6024
569
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1506
ORDER BY `position`
0.364 ms 1 Yes /classes/Product.php:3539
715
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.364 ms 1 Yes Yes /classes/Product.php:4513
369
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1538
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
381
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1506
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
270
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1310
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
313
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1304
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
450
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1608
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
706
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1187) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.363 ms 1 Yes Yes /classes/Product.php:4513
41
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.362 ms 1 /src/Adapter/EntityMapper.php:71
506
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 747
ORDER BY `position`
0.362 ms 1 Yes /classes/Product.php:3539
59
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.362 ms 1 /src/Adapter/EntityMapper.php:71
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 747
ORDER BY f.position ASC
0.362 ms 1 Yes /classes/Product.php:6024
240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2434
ORDER BY f.position ASC
0.361 ms 1 Yes /classes/Product.php:6024
281
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2474
ORDER BY f.position ASC
0.361 ms 1 Yes /classes/Product.php:6024
322
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1316
ORDER BY f.position ASC
0.361 ms 1 Yes /classes/Product.php:6024
599
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.361 ms 1 /classes/module/Module.php:2664
49
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1
0.360 ms 1 /src/Adapter/EntityMapper.php:71
555
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1305
ORDER BY `position`
0.360 ms 1 Yes /classes/Product.php:3539
591
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1556
ORDER BY `position`
0.360 ms 1 Yes /classes/Product.php:3539
9
SELECT SQL_NO_CACHE *
FROM `och438lang` a
LEFT JOIN `och438lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.359 ms 1 /src/Adapter/EntityMapper.php:71
25
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.359 ms 1 /classes/Language.php:880
588
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1521
ORDER BY `position`
0.359 ms 1 Yes /classes/Product.php:3539
210
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1620
ORDER BY f.position ASC
0.359 ms 1 Yes /classes/Product.php:6024
148
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 749)
0.358 ms 1 /classes/Product.php:3860
508
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 749
ORDER BY `position`
0.358 ms 1 Yes /classes/Product.php:3539
474
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1521
ORDER BY f.position ASC
0.358 ms 1 Yes /classes/Product.php:6024
486
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1486
AND image_shop.`cover` = 1 LIMIT 1
0.358 ms 1 /classes/Product.php:3570
28
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.357 ms 1 /classes/Language.php:880
265
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1310)
0.357 ms 1 /classes/Product.php:3860
393
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1187
AND image_shop.`cover` = 1 LIMIT 1
0.356 ms 3 /classes/Product.php:3570
538
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1310
ORDER BY `position`
0.356 ms 1 Yes /classes/Product.php:3539
38
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 26) AND (b.`id_shop` = 1) LIMIT 1
0.356 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM och438shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.355 ms 1 /classes/shop/ShopUrl.php:178
499
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 701
ORDER BY `position`
0.355 ms 1 Yes /classes/Product.php:3539
7
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
47
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 94) AND (b.`id_shop` = 1) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
504
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1314
ORDER BY `position`
0.354 ms 1 Yes /classes/Product.php:3539
601
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `och438currency` c
LEFT JOIN och438currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.354 ms 1 /classes/Currency.php:1134
577
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1607
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3539
687
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1306 LIMIT 1
0.353 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
741
SELECT SQL_NO_CACHE c.*, cl.*  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 121 ORDER BY `nleft` DESC
0.353 ms 4 /classes/Category.php:1594
27
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.352 ms 1 /src/Adapter/EntityMapper.php:71
510
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 770
ORDER BY `position`
0.352 ms 1 Yes /classes/Product.php:3539
575
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1187
ORDER BY `position`
0.352 ms 3 Yes /classes/Product.php:3539
230
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1308
ORDER BY f.position ASC
0.351 ms 1 Yes /classes/Product.php:6024
106
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 701)
0.350 ms 1 /classes/Product.php:3860
176
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 783
ORDER BY f.position ASC
0.350 ms 1 Yes /classes/Product.php:6024
410
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1607)
0.350 ms 1 /classes/Product.php:3860
476
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.350 ms 1 /classes/Product.php:5670
543
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1485
ORDER BY `position`
0.350 ms 1 Yes /classes/Product.php:3539
547
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2521
0.349 ms 1 /classes/Product.php:2899
593
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1486
ORDER BY `position`
0.349 ms 1 Yes /classes/Product.php:3539
39
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 29) AND (b.`id_shop` = 1) LIMIT 1
0.349 ms 1 /src/Adapter/EntityMapper.php:71
165
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 770
ORDER BY f.position ASC
0.349 ms 1 Yes /classes/Product.php:6024
294
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2521
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
376
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1506)
0.349 ms 1 /classes/Product.php:3860
124
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1314)
0.348 ms 1 /classes/Product.php:3860
627
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1314 LIMIT 1
0.348 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
404
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1607
AND image_shop.`cover` = 1 LIMIT 1
0.348 ms 1 /classes/Product.php:3570
138
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 747 AND `id_group` = 1 LIMIT 1
0.347 ms 0 /classes/GroupReduction.php:153
519
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2662
ORDER BY `position`
0.347 ms 1 Yes /classes/Product.php:3539
29
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.347 ms 1 /src/Adapter/EntityMapper.php:71
331
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1305
ORDER BY f.position ASC
0.347 ms 1 Yes /classes/Product.php:6024
439
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1608
AND image_shop.`cover` = 1 LIMIT 1
0.347 ms 1 /classes/Product.php:3570
24
SELECT SQL_NO_CACHE * FROM `och438currency` c ORDER BY `iso_code` ASC
0.345 ms 1 Yes /classes/Currency.php:708
595
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c WHERE c.id_category = 22 LIMIT 1
0.345 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
617
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.345 ms 1 /classes/module/Module.php:2664
32
SELECT SQL_NO_CACHE *
FROM `och438group` a
LEFT JOIN `och438group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.344 ms 1 /src/Adapter/EntityMapper.php:71
42
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 41) AND (b.`id_shop` = 1) LIMIT 1
0.344 ms 1 /src/Adapter/EntityMapper.php:71
462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1496
ORDER BY f.position ASC
0.344 ms 1 Yes /classes/Product.php:6024
546
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2521
ORDER BY `position`
0.344 ms 1 Yes /classes/Product.php:3539
36
SELECT SQL_NO_CACHE ctg.`id_group`
FROM och438category_group ctg
WHERE ctg.`id_category` = 22 AND ctg.`id_group` = 1 LIMIT 1
0.343 ms 1 /classes/Category.php:1751
186
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1814
ORDER BY f.position ASC
0.343 ms 1 Yes /classes/Product.php:6024
197
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2662
ORDER BY f.position ASC
0.343 ms 1 Yes /classes/Product.php:6024
717
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1608 LIMIT 1
0.343 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
115
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.342 ms 0 /classes/tax/TaxRulesTaxManager.php:100
729
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1486 LIMIT 1
0.342 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
558
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1306
ORDER BY `position`
0.342 ms 1 Yes /classes/Product.php:3539
276
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2474)
0.341 ms 1 /classes/Product.php:3860
308
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1304)
0.340 ms 1 /classes/Product.php:3860
516
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1814
ORDER BY `position`
0.340 ms 1 Yes /classes/Product.php:3539
738
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.340 ms 1 /src/Adapter/EntityMapper.php:71
64
SELECT SQL_NO_CACHE `name`
FROM `och438hook`
WHERE `id_hook` = 746 LIMIT 1
0.339 ms 1 /classes/Hook.php:244
103
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `to` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.339 ms 1 /classes/SpecificPrice.php:381
567
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1538
ORDER BY `position`
0.338 ms 1 Yes /classes/Product.php:3539
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM och438shop s
LEFT JOIN och438shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.338 ms 1 /classes/shop/Shop.php:214
317
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1316)
0.338 ms 1 /classes/Product.php:3860
56
SELECT SQL_NO_CACHE * FROM `och438image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.337 ms 8 Yes /classes/ImageType.php:109
113
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 701 AND `id_group` = 1 LIMIT 1
0.337 ms 0 /classes/GroupReduction.php:153
387
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1186)
0.337 ms 1 /classes/Product.php:3860
359
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1538
AND image_shop.`cover` = 1 LIMIT 1
0.337 ms 1 /classes/Product.php:3570
241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1313
AND image_shop.`cover` = 1 LIMIT 1
0.336 ms 1 /classes/Product.php:3570
349
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1307
ORDER BY f.position ASC
0.336 ms 1 Yes /classes/Product.php:6024
353
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1233)
0.336 ms 1 /classes/Product.php:3860
45
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
0.335 ms 1 /src/Adapter/EntityMapper.php:71
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 747)
0.335 ms 1 /classes/Product.php:3860
179
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 26 LIMIT 1
0.335 ms 1 /classes/Product.php:5670
216
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2473)
0.335 ms 1 /classes/Product.php:3860
307
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1304 LIMIT 1
0.335 ms 1 /classes/SpecificPrice.php:435
564
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1233
ORDER BY `position`
0.335 ms 1 Yes /classes/Product.php:3539
586
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1496
ORDER BY `position`
0.335 ms 1 Yes /classes/Product.php:3539
592
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1556
0.335 ms 1 /classes/Product.php:2899
621
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 701
0.335 ms 3 /classes/Product.php:3420
624
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 701 LIMIT 1
0.335 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
572
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1186
ORDER BY `position`
0.334 ms 1 Yes /classes/Product.php:3539
675
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2521 LIMIT 1
0.334 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
40
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
43
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) AND (b.`id_shop` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1313)
0.333 ms 1 /classes/Product.php:3860
445
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1608)
0.333 ms 1 /classes/Product.php:3860
44
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 43) AND (b.`id_shop` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
552
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1316
ORDER BY `position`
0.332 ms 1 Yes /classes/Product.php:3539
638
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 783
0.332 ms 3 /classes/Product.php:3420
225
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1308)
0.331 ms 1 /classes/Product.php:3860
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `och438hook_alias`
0.331 ms 88 /classes/Hook.php:290
542
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2474
0.331 ms 1 /classes/Product.php:2899
737
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.331 ms 1 /classes/Category.php:2239
52
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 274) AND (b.`id_shop` = 1) LIMIT 1
0.330 ms 1 /src/Adapter/EntityMapper.php:71
651
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2473 LIMIT 1
0.330 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
332
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1306
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
198
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1620
AND image_shop.`cover` = 1 LIMIT 1
0.328 ms 1 /classes/Product.php:3570
271
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2474
AND image_shop.`cover` = 1 LIMIT 1
0.328 ms 1 /classes/Product.php:3570
326
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1305)
0.328 ms 1 /classes/Product.php:3860
335
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1306)
0.328 ms 1 /classes/Product.php:3860
428
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1543
AND image_shop.`cover` = 1 LIMIT 1
0.328 ms 2 /classes/Product.php:3570
433
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1543)
0.328 ms 1 /classes/Product.php:3860
579
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1537
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
744
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.328 ms 1 /classes/module/Module.php:2664
642
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1814 LIMIT 1
0.327 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
530
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2434
ORDER BY `position`
0.327 ms 1 Yes /classes/Product.php:3539
561
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1307
ORDER BY `position`
0.327 ms 1 Yes /classes/Product.php:3539
46
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) AND (b.`id_shop` = 1) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
636
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 770 LIMIT 1
0.326 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
50
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 138) AND (b.`id_shop` = 1) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
533
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1313
ORDER BY `position`
0.326 ms 1 Yes /classes/Product.php:3539
535
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1494
ORDER BY `position`
0.326 ms 1 Yes /classes/Product.php:3539
615
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.326 ms 1 /classes/module/Module.php:2664
344
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1307)
0.325 ms 1 /classes/Product.php:3860
370
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1506
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
61
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM och438required_field
0.325 ms 1 /classes/ObjectModel.php:1592
73
SELECT SQL_NO_CACHE data FROM och438layered_filter_block WHERE hash="be545d6b0364ef057e83e8b467001d10" LIMIT 1
0.325 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
288
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1485)
0.325 ms 1 /classes/Product.php:3860
314
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1316
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
364
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1538)
0.325 ms 1 /classes/Product.php:3860
495
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1486) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:453
513
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 783
ORDER BY `position`
0.325 ms 1 Yes /classes/Product.php:3539
549
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1304
ORDER BY `position`
0.325 ms 1 Yes /classes/Product.php:3539
641
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1814
0.325 ms 2 /classes/Product.php:3420
53
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 275) AND (b.`id_shop` = 1) LIMIT 1
0.324 ms 1 /src/Adapter/EntityMapper.php:71
57
SELECT SQL_NO_CACHE format
FROM `och438address_format`
WHERE `id_country` = 6 LIMIT 1
0.324 ms 1 /classes/AddressFormat.php:653
192
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2662)
0.324 ms 1 /classes/Product.php:3860
416
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1537
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
541
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2474
ORDER BY `position`
0.324 ms 1 Yes /classes/Product.php:3539
382
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1186
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
475
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1556
AND image_shop.`cover` = 1 LIMIT 1
0.323 ms 1 /classes/Product.php:3570
635
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 770
0.323 ms 2 /classes/Product.php:3420
657
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2434 LIMIT 1
0.323 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
671
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1485
0.323 ms 3 /classes/Product.php:3420
690
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1307 LIMIT 1
0.323 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
492
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1486)
0.323 ms 1 /classes/Product.php:3860
262
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1310
AND image_shop.`cover` = 1 LIMIT 1
0.322 ms 1 /classes/Product.php:3570
619
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.322 ms 1 /classes/module/Module.php:2664
235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2434)
0.322 ms 1 /classes/Product.php:3860
451
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1496
AND image_shop.`cover` = 1 LIMIT 1
0.322 ms 1 /classes/Product.php:3570
401
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1187) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.321 ms 1 /classes/stock/StockAvailable.php:453
63
SELECT SQL_NO_CACHE * FROM och438revslider_sliders
0.320 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1521
AND image_shop.`cover` = 1 LIMIT 1
0.320 ms 1 /classes/Product.php:3570
480
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1556)
0.320 ms 1 /classes/Product.php:3860
205
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1620)
0.320 ms 1 /classes/Product.php:3860
211
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2473
AND image_shop.`cover` = 1 LIMIT 1
0.320 ms 1 /classes/Product.php:3570
582
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1543
ORDER BY `position`
0.320 ms 2 Yes /classes/Product.php:3539
630
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 747 LIMIT 1
0.320 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `och438lang` l
LEFT JOIN `och438lang_shop` ls ON (l.id_lang = ls.id_lang)
0.319 ms 1 /classes/Language.php:1080
48
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
60
SELECT SQL_NO_CACHE *
FROM `och438country_lang`
WHERE `id_country` = 6
0.319 ms 1 /src/Adapter/EntityMapper.php:79
398
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1187)
0.319 ms 1 /classes/Product.php:3860
524
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2473
ORDER BY `position`
0.319 ms 1 Yes /classes/Product.php:3539
629
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 747
0.319 ms 2 /classes/Product.php:3420
639
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 783 LIMIT 1
0.319 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
720
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1496 LIMIT 1
0.319 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
71
SELECT SQL_NO_CACHE *
FROM `och438category_lang`
WHERE `id_category` = 22 AND `id_shop` = 1
0.318 ms 1 /src/Adapter/EntityMapper.php:79
160
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 770)
0.318 ms 1 /classes/Product.php:3860
677
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1304
0.318 ms 2 /classes/Product.php:3420
722
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1521
0.318 ms 3 /classes/Product.php:3420
34
SELECT SQL_NO_CACHE id_shop
FROM `och438group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.318 ms 1 /classes/ObjectModel.php:1727
58
SELECT SQL_NO_CACHE `need_identification_number`
FROM `och438country`
WHERE `id_country` = 6 LIMIT 1
0.318 ms 1 /classes/Country.php:402
302
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
725
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1556
0.317 ms 2 /classes/Product.php:3420
726
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1556 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1494
AND image_shop.`cover` = 1 LIMIT 1
0.317 ms 1 /classes/Product.php:3570
654
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1308 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
669
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2474 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
296
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2521 LIMIT 1
0.316 ms 1 /classes/SpecificPrice.php:435
26
SELECT SQL_NO_CACHE c.id_currency
FROM `och438currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.316 ms 1 /classes/Currency.php:893
300
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2521 AND id_shop=1 LIMIT 1
0.316 ms 1 /classes/Product.php:6884
728
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1486
0.316 ms 2 /classes/Product.php:3420
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 747) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.315 ms 1 /classes/stock/StockAvailable.php:453
297
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.315 ms 1 /classes/SpecificPrice.php:256
648
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1620 LIMIT 1
0.315 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
672
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1485 LIMIT 1
0.315 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
680
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1316
0.315 ms 2 /classes/Product.php:3420
711
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1537 LIMIT 1
0.315 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
51
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 272) AND (b.`id_shop` = 1) LIMIT 1
0.314 ms 1 /src/Adapter/EntityMapper.php:71
224
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1308 LIMIT 1
0.314 ms 1 /classes/SpecificPrice.php:435
656
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2434
0.314 ms 1 /classes/Product.php:3420
681
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1316 LIMIT 1
0.314 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
701
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1186
0.314 ms 2 /classes/Product.php:3420
99
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 701 LIMIT 1
0.313 ms 1 /classes/SpecificPrice.php:435
256
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1494)
0.313 ms 1 /classes/Product.php:3860
320
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1316) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:453
350
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1233
AND image_shop.`cover` = 1 LIMIT 1
0.313 ms 1 /classes/Product.php:3570
422
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1537)
0.313 ms 1 /classes/Product.php:3860
674
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2521
0.313 ms 2 /classes/Product.php:3420
683
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1305
0.313 ms 3 /classes/Product.php:3420
600
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.313 ms 1 /classes/module/Module.php:2137
633
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 749 LIMIT 1
0.313 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
323
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1305
AND image_shop.`cover` = 1 LIMIT 1
0.312 ms 1 /classes/Product.php:3570
666
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1310 LIMIT 1
0.312 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
684
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1305 LIMIT 1
0.312 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
167
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.311 ms 1 /classes/Product.php:5670
678
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1304 LIMIT 1
0.311 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
733
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c LEFT JOIN och438iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 22 AND s.id_shop = 1 LIMIT 1
0.311 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
54
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.311 ms 0 /classes/module/Module.php:2664
693
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1233 LIMIT 1
0.311 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
177
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1814
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
257
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1494 AND id_shop=1 LIMIT 1
0.310 ms 1 /classes/Product.php:6884
10
SELECT SQL_NO_CACHE id_shop
FROM `och438lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.310 ms 1 /classes/ObjectModel.php:1727
616
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.310 ms 1 /classes/module/Module.php:2137
723
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1521 LIMIT 1
0.310 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
100
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `id_product` != 0 LIMIT 1
0.309 ms 521 /classes/SpecificPrice.php:297
171
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 783)
0.309 ms 1 /classes/Product.php:3860
187
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2662
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
222
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1308
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
527
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1308
ORDER BY `position`
0.309 ms 1 Yes /classes/Product.php:3539
653
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1308
0.309 ms 2 /classes/Product.php:3420
696
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1538 LIMIT 1
0.309 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
714
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1543 LIMIT 1
0.309 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
716
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1608
0.309 ms 2 /classes/Product.php:3420
154
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 770
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1496)
0.308 ms 1 /classes/Product.php:3860
587
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1496
0.308 ms 1 /classes/Product.php:2899
668
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2474
0.308 ms 1 /classes/Product.php:3420
489
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1486 LIMIT 1
0.307 ms 1 /classes/SpecificPrice.php:435
395
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1187 LIMIT 1
0.307 ms 1 /classes/SpecificPrice.php:435
469
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1521)
0.307 ms 1 /classes/Product.php:3860
705
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1187 LIMIT 1
0.307 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
4
SELECT SQL_NO_CACHE *
FROM `och438shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.306 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2434
AND image_shop.`cover` = 1 LIMIT 1
0.306 ms 1 /classes/Product.php:3570
282
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1485
AND image_shop.`cover` = 1 LIMIT 1
0.306 ms 1 /classes/Product.php:3570
361
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1538 LIMIT 1
0.306 ms 1 /classes/SpecificPrice.php:435
501
SELECT SQL_NO_CACHE state FROM och438feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.306 ms 1 /classes/FeatureFlag.php:105
390
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1186) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
483
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1556) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
585
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1608
0.305 ms 1 /classes/Product.php:2899
612
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsearch" LIMIT 1
0.305 ms 1 /classes/module/Module.php:2664
645
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2662 LIMIT 1
0.305 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
396
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1187
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.304 ms 1 /classes/SpecificPrice.php:256
650
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2473
0.304 ms 1 /classes/Product.php:3420
689
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1307
0.304 ms 2 /classes/Product.php:3420
713
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1543
0.304 ms 2 /classes/Product.php:3420
264
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1310 LIMIT 1
0.303 ms 1 /classes/SpecificPrice.php:435
295
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.303 ms 1 /classes/Product.php:5670
316
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1316 LIMIT 1
0.303 ms 1 /classes/SpecificPrice.php:435
632
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 749
0.303 ms 2 /classes/Product.php:3420
660
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1313 LIMIT 1
0.303 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
665
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1310
0.303 ms 2 /classes/Product.php:3420
699
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1506 LIMIT 1
0.303 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
30
SELECT SQL_NO_CACHE *
FROM `och438currency_lang`
WHERE `id_currency` = 1
0.302 ms 1 /src/Adapter/EntityMapper.php:79
228
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1308) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
291
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1485) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
425
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
719
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1496
0.301 ms 2 /classes/Product.php:3420
752
SELECT SQL_NO_CACHE data
FROM `och438ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.301 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:39
65
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.301 ms 1 /classes/Category.php:2446
301
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2521 AND `id_group` = 1 LIMIT 1
0.301 ms 0 /classes/GroupReduction.php:153
311
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.301 ms 1 /classes/stock/StockAvailable.php:453
341
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1307
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 1 /classes/Product.php:3570
659
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1313
0.300 ms 3 /classes/Product.php:3420
266
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1310 AND id_shop=1 LIMIT 1
0.300 ms 1 /classes/Product.php:6884
460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1496) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.300 ms 1 /classes/stock/StockAvailable.php:453
662
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1494
0.300 ms 2 /classes/Product.php:3420
31
SELECT SQL_NO_CACHE id_shop
FROM `och438currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.299 ms 1 /classes/ObjectModel.php:1727
55
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.299 ms 0 /classes/module/Module.php:2137
367
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
644
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2662
0.299 ms 2 /classes/Product.php:3420
663
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1494 LIMIT 1
0.299 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
702
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1186 LIMIT 1
0.299 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
405
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.298 ms 1 /classes/Product.php:5670
500
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 701
0.298 ms 1 /classes/Product.php:2899
336
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1306 AND id_shop=1 LIMIT 1
0.297 ms 1 /classes/Product.php:6884
347
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:453
356
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1233) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:453
384
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1186 LIMIT 1
0.297 ms 1 /classes/SpecificPrice.php:435
731
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitelementor" LIMIT 1
0.297 ms 1 /classes/module/Module.php:2664
742
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.297 ms 1 /classes/module/Module.php:2664
70
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
440
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.297 ms 1 /classes/Product.php:5670
442
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1608 LIMIT 1
0.297 ms 1 /classes/SpecificPrice.php:435
505
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1314
0.297 ms 1 /classes/Product.php:2899
21
SELECT SQL_NO_CACHE * FROM `och438hook_module_exceptions`
WHERE `id_shop` IN (1)
0.296 ms 1 /classes/module/Module.php:2046
698
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1506
0.296 ms 3 /classes/Product.php:3420
306
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.296 ms 1 /classes/Product.php:5670
623
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 83 AND `id_shop` = 1 LIMIT 1
0.296 ms 1 /classes/module/Module.php:2137
746
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitpopup" LIMIT 1
0.295 ms 1 /classes/module/Module.php:2664
502
SELECT SQL_NO_CACHE * FROM `och438image_type`
0.295 ms 8 /classes/ImageType.php:161
511
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 770
0.295 ms 1 /classes/Product.php:2899
520
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2662
0.295 ms 1 /classes/Product.php:2899
692
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1233
0.295 ms 2 /classes/Product.php:3420
695
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1538
0.295 ms 2 /classes/Product.php:3420
603
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 68 AND `id_shop` = 1 LIMIT 1
0.294 ms 1 /classes/module/Module.php:2137
704
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1187
0.294 ms 2 /classes/Product.php:3420
373
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1506 LIMIT 1
0.294 ms 1 /classes/SpecificPrice.php:435
377
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1506 AND id_shop=1 LIMIT 1
0.294 ms 1 /classes/Product.php:6884
114
SELECT SQL_NO_CACHE `reduction`
FROM `och438group`
WHERE `id_group` = 1 LIMIT 1
0.293 ms 1 /classes/Group.php:151
234
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2434 LIMIT 1
0.293 ms 1 /classes/SpecificPrice.php:435
407
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1607 LIMIT 1
0.293 ms 1 /classes/SpecificPrice.php:435
419
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1537 LIMIT 1
0.293 ms 1 /classes/SpecificPrice.php:435
436
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:453
576
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1187
0.293 ms 1 /classes/Product.php:2899
613
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.293 ms 1 /classes/module/Module.php:2137
352
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1233 LIMIT 1
0.292 ms 1 /classes/SpecificPrice.php:435
379
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1506) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
434
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1543 AND id_shop=1 LIMIT 1
0.292 ms 1 /classes/Product.php:6884
430
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1543 LIMIT 1
0.292 ms 1 /classes/SpecificPrice.php:435
319
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1316 AND `id_group` = 1 LIMIT 1
0.291 ms 0 /classes/GroupReduction.php:153
365
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1538 AND id_shop=1 LIMIT 1
0.291 ms 1 /classes/Product.php:6884
394
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.291 ms 1 /classes/Product.php:5670
481
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1556 AND id_shop=1 LIMIT 1
0.291 ms 1 /classes/Product.php:6884
710
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1537
0.291 ms 2 /classes/Product.php:3420
413
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1607) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:453
732
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.291 ms 1 /classes/module/Module.php:2137
251
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.290 ms 1 /classes/Product.php:5670
562
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1307
0.290 ms 1 /classes/Product.php:2899
745
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.290 ms 1 /classes/module/Module.php:2137
277
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2474 AND id_shop=1 LIMIT 1
0.290 ms 1 /classes/Product.php:6884
620
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 64 AND `id_shop` = 1 LIMIT 1
0.290 ms 1 /classes/module/Module.php:2137
247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1313) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
163
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 770) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
259
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1494) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.289 ms 1 /classes/stock/StockAvailable.php:453
487
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.289 ms 1 /classes/Product.php:5670
565
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1233
0.289 ms 1 /classes/Product.php:2899
605
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.289 ms 1 /classes/module/Module.php:2137
174
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 783) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.288 ms 1 /classes/stock/StockAvailable.php:453
263
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.288 ms 1 /classes/Product.php:5670
522
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1620
0.288 ms 1 /classes/Product.php:2899
602
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.288 ms 1 /classes/module/Module.php:2664
33
SELECT SQL_NO_CACHE *
FROM `och438group_lang`
WHERE `id_group` = 1
0.287 ms 1 /src/Adapter/EntityMapper.php:79
411
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1607 AND id_shop=1 LIMIT 1
0.287 ms 1 /classes/Product.php:6884
707
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1607
0.287 ms 2 /classes/Product.php:3420
223
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.287 ms 1 /classes/Product.php:5670
149
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 749 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6884
238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2434) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
604
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_languageselector" LIMIT 1
0.286 ms 1 /classes/module/Module.php:2664
242
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.285 ms 1 /classes/Product.php:5670
273
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2474 LIMIT 1
0.285 ms 1 /classes/SpecificPrice.php:435
735
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.285 ms 1 /classes/module/Module.php:2137
96
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.285 ms 1 /classes/Product.php:5670
217
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2473 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6884
374
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1506
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.285 ms 0 /classes/SpecificPrice.php:256
509
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 749
0.285 ms 1 /classes/Product.php:2899
517
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1814
0.285 ms 1 /classes/Product.php:2899
399
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1187 AND id_shop=1 LIMIT 1
0.284 ms 1 /classes/Product.php:6884
466
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1521 LIMIT 1
0.284 ms 1 /classes/SpecificPrice.php:435
477
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1556 LIMIT 1
0.284 ms 1 /classes/SpecificPrice.php:435
570
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1506
0.284 ms 1 /classes/Product.php:2899
594
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1486
0.284 ms 1 /classes/Product.php:2899
178
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 26 LIMIT 1
0.283 ms 1 /classes/Category.php:1373
219
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
318
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1316 AND id_shop=1 LIMIT 1
0.283 ms 1 /classes/Product.php:6884
553
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1316
0.283 ms 1 /classes/Product.php:2899
556
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1305
0.283 ms 1 /classes/Product.php:2899
743
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.283 ms 1 /classes/module/Module.php:2137
95
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 22 LIMIT 1
0.282 ms 1 /classes/Category.php:1373
388
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1186 AND id_shop=1 LIMIT 1
0.282 ms 1 /classes/Product.php:6884
536
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1494
0.282 ms 1 /classes/Product.php:2899
544
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1485
0.282 ms 1 /classes/Product.php:2899
568
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1538
0.282 ms 1 /classes/Product.php:2899
573
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1186
0.282 ms 1 /classes/Product.php:2899
734
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_categorytree" LIMIT 1
0.282 ms 1 /classes/module/Module.php:2664
104
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 701
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.282 ms 0 /classes/SpecificPrice.php:256
274
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2474
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.282 ms 1 /classes/SpecificPrice.php:256
334
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1306 LIMIT 1
0.281 ms 1 /classes/SpecificPrice.php:435
268
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1310) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
343
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1307 LIMIT 1
0.280 ms 1 /classes/SpecificPrice.php:435
507
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 747
0.280 ms 1 /classes/Product.php:2899
208
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1620) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
267
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1310 AND `id_group` = 1 LIMIT 1
0.280 ms 0 /classes/GroupReduction.php:153
338
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.280 ms 1 /classes/stock/StockAvailable.php:453
383
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.280 ms 1 /classes/Product.php:5670
493
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1486 AND id_shop=1 LIMIT 1
0.280 ms 1 /classes/Product.php:6884
279
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
360
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.279 ms 1 /classes/Product.php:5670
448
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1608) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
472
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
589
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1521
0.279 ms 1 /classes/Product.php:2899
0
SELECT SQL_NO_CACHE * FROM och438memcached_servers
0.278 ms 1 /classes/cache/CacheMemcached.php:263
8
SELECT SQL_NO_CACHE *
FROM `och438shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.278 ms 1 /src/Adapter/EntityMapper.php:71
233
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.278 ms 1 /classes/Product.php:5670
286
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1485
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.278 ms 1 /classes/SpecificPrice.php:256
342
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.278 ms 1 /classes/Product.php:5670
525
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2473
0.278 ms 1 /classes/Product.php:2899
739
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 22 LIMIT 1
0.278 ms 1 /classes/Category.php:1584
120
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 40 LIMIT 1
0.277 ms 1 /classes/Category.php:1373
285
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1485 LIMIT 1
0.277 ms 1 /classes/SpecificPrice.php:435
329
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.277 ms 1 /classes/stock/StockAvailable.php:453
389
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1186 AND `id_group` = 1 LIMIT 1
0.277 ms 0 /classes/GroupReduction.php:153
443
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1608
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.277 ms 0 /classes/SpecificPrice.php:256
514
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 783
0.277 ms 1 /classes/Product.php:2899
578
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1607
0.277 ms 1 /classes/Product.php:2899
583
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1543
0.277 ms 1 /classes/Product.php:2899
371
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.276 ms 1 /classes/Product.php:5670
559
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1306
0.276 ms 1 /classes/Product.php:2899
253
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1494 LIMIT 1
0.276 ms 1 /classes/SpecificPrice.php:435
490
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1486
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.276 ms 0 /classes/SpecificPrice.php:256
254
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1494
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.275 ms 1 /classes/SpecificPrice.php:256
272
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.275 ms 1 /classes/Product.php:5670
539
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1310
0.275 ms 1 /classes/Product.php:2899
749
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.275 ms 1 /classes/module/Module.php:2137
237
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2434 AND `id_group` = 1 LIMIT 1
0.275 ms 0 /classes/GroupReduction.php:153
289
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1485 AND id_shop=1 LIMIT 1
0.275 ms 1 /classes/Product.php:6884
385
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1186
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.275 ms 0 /classes/SpecificPrice.php:256
452
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.275 ms 1 /classes/Product.php:5670
168
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 783 LIMIT 1
0.274 ms 1 /classes/SpecificPrice.php:435
315
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.274 ms 1 /classes/Product.php:5670
195
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2662) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
227
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1308 AND `id_group` = 1 LIMIT 1
0.274 ms 0 /classes/GroupReduction.php:153
245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1313 AND id_shop=1 LIMIT 1
0.274 ms 1 /classes/Product.php:6884
431
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1543
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.274 ms 0 /classes/SpecificPrice.php:256
184
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1814) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.273 ms 1 /classes/stock/StockAvailable.php:453
429
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.273 ms 1 /classes/Product.php:5670
446
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1608 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6884
550
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1304
0.273 ms 1 /classes/Product.php:2899
580
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1537
0.273 ms 1 /classes/Product.php:2899
606
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.273 ms 1 /classes/module/Module.php:2664
125
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1314 AND id_shop=1 LIMIT 1
0.272 ms 1 /classes/Product.php:6884
243
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1313 LIMIT 1
0.272 ms 1 /classes/SpecificPrice.php:435
534
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1313
0.272 ms 1 /classes/Product.php:2899
191
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2662 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
202
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1620 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
213
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2473 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
345
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1307 AND id_shop=1 LIMIT 1
0.271 ms 1 /classes/Product.php:6884
454
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1496 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
157
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 770 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
182
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1814 AND id_shop=1 LIMIT 1
0.271 ms 1 /classes/Product.php:6884
236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2434 AND id_shop=1 LIMIT 1
0.271 ms 1 /classes/Product.php:6884
327
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1305 AND id_shop=1 LIMIT 1
0.271 ms 1 /classes/Product.php:6884
420
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1537
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.270 ms 0 /classes/SpecificPrice.php:256
610
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcompare" LIMIT 1
0.270 ms 1 /classes/module/Module.php:2664
151
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 749) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
212
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 26 LIMIT 1
0.270 ms 1 /classes/Product.php:5670
309
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1304 AND id_shop=1 LIMIT 1
0.270 ms 1 /classes/Product.php:6884
747
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1
0.270 ms 1 /classes/module/Module.php:2137
199
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 44 LIMIT 1
0.269 ms 1 /classes/Category.php:1373
351
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
337
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1306 AND `id_group` = 1 LIMIT 1
0.269 ms 0 /classes/GroupReduction.php:153
366
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1538 AND `id_group` = 1 LIMIT 1
0.269 ms 0 /classes/GroupReduction.php:153
423
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1537 AND id_shop=1 LIMIT 1
0.269 ms 1 /classes/Product.php:6884
464
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
155
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.268 ms 1 /classes/Product.php:5670
161
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 770 AND id_shop=1 LIMIT 1
0.268 ms 1 /classes/Product.php:6884
283
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.268 ms 1 /classes/Product.php:5670
607
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.268 ms 1 /classes/module/Module.php:2137
206
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1620 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6884
324
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
333
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1496 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6884
470
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1521 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6884
408
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1607
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.267 ms 0 /classes/SpecificPrice.php:256
169
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 783
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.266 ms 1 /classes/SpecificPrice.php:256
190
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 126
AND `active` = 1 LIMIT 1
0.266 ms 1 /classes/Manufacturer.php:312
417
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.266 ms 1 /classes/Product.php:5670
146
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 749
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.266 ms 0 /classes/SpecificPrice.php:256
188
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 41 LIMIT 1
0.266 ms 1 /classes/Category.php:1373
740
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c
WHERE c.`id_category` = 2 LIMIT 1
0.266 ms 1 /classes/Category.php:1589
232
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 29 LIMIT 1
0.265 ms 1 /classes/Category.php:1373
378
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1506 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:153
455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1496
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.265 ms 0 /classes/SpecificPrice.php:256
467
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.265 ms 0 /classes/SpecificPrice.php:256
471
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1521 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:153
609
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.265 ms 1 /classes/module/Module.php:2137
123
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1314 LIMIT 1
0.264 ms 1 /classes/SpecificPrice.php:435
214
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2473
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.264 ms 1 /classes/SpecificPrice.php:256
362
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1538
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.264 ms 0 /classes/SpecificPrice.php:256
531
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2434
0.264 ms 1 /classes/Product.php:2899
748
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.264 ms 1 /classes/module/Module.php:2664
193
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2662 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6884
226
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1308 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6884
246
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1313 AND `id_group` = 1 LIMIT 1
0.263 ms 0 /classes/GroupReduction.php:153
478
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1556
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.263 ms 0 /classes/SpecificPrice.php:256
150
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 749 AND `id_group` = 1 LIMIT 1
0.262 ms 0 /classes/GroupReduction.php:153
528
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1308
0.262 ms 1 /classes/Product.php:2899
121
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 40 LIMIT 1
0.261 ms 1 /classes/Product.php:5670
618
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.261 ms 1 /classes/module/Module.php:2137
203
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1620
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.261 ms 0 /classes/SpecificPrice.php:256
608
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitwishlist" LIMIT 1
0.261 ms 1 /classes/module/Module.php:2664
400
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1187 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:153
412
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1607 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:153
143
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.259 ms 1 /classes/Product.php:5670
278
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2474 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:153
355
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1233 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:153
482
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1556 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:153
354
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1233 AND id_shop=1 LIMIT 1
0.258 ms 1 /classes/Product.php:6884
173
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 783 AND `id_group` = 1 LIMIT 1
0.257 ms 0 /classes/GroupReduction.php:153
189
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.256 ms 1 /classes/Product.php:5670
200
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.256 ms 1 /classes/Product.php:5670
611
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 69 AND `id_shop` = 1 LIMIT 1
0.256 ms 1 /classes/module/Module.php:2137
435
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1543 AND `id_group` = 1 LIMIT 1
0.256 ms 0 /classes/GroupReduction.php:153
158
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 770
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.255 ms 0 /classes/SpecificPrice.php:256
218
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2473 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:153
310
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1304 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:153
424
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1537 AND `id_group` = 1 LIMIT 1
0.255 ms 0 /classes/GroupReduction.php:153
346
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1307 AND `id_group` = 1 LIMIT 1
0.254 ms 0 /classes/GroupReduction.php:153
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 747 AND id_shop=1 LIMIT 1
0.254 ms 1 /classes/Product.php:6884
459
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1496 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:153
258
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1494 AND `id_group` = 1 LIMIT 1
0.252 ms 0 /classes/GroupReduction.php:153
131
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.251 ms 1 /classes/Product.php:5670
162
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 770 AND `id_group` = 1 LIMIT 1
0.249 ms 0 /classes/GroupReduction.php:153
183
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1814 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:153
290
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1485 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:153
447
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1608 AND `id_group` = 1 LIMIT 1
0.248 ms 0 /classes/GroupReduction.php:153
122
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 57
AND `active` = 1 LIMIT 1
0.245 ms 1 /classes/Manufacturer.php:312
126
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1314 AND `id_group` = 1 LIMIT 1
0.245 ms 0 /classes/GroupReduction.php:153
328
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1305 AND `id_group` = 1 LIMIT 1
0.244 ms 0 /classes/GroupReduction.php:153
494
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1486 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:153
194
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2662 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:153
134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 747
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.241 ms 0 /classes/SpecificPrice.php:256
207
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1620 AND `id_group` = 1 LIMIT 1
0.238 ms 0 /classes/GroupReduction.php:153

Doubles

37 queries
SELECT XX FROM `ochXXspecific_price` WHERE id_product = XX LIMIT XX
36 queries
SELECT image_shop.`id_image`
                    FROM `ochXXimage` i
                     INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
36 queries
SELECT name FROM ochXXcategory_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
36 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ochXXproduct` p
INNER JOIN `ochXXproduct_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `ochXXproduct_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
36 queries
                            SELECT `id_tax_rules_group`
                            FROM `ochXXproduct_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
36 queries
			SELECT `reduction`
			FROM `ochXXproduct_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
36 queries
SELECT SUM(quantity)
FROM `ochXXstock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
36 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `ochXXcart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `ochXXcart_product` cp JOIN `ochXXpack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ochXXproduct` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
36 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM ochXXfeature_product pf
                LEFT JOIN ochXXfeature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN ochXXfeature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN ochXXfeature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN ochXXfeature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
36 queries
SELECT *
FROM `ochXXproduct` a
LEFT JOIN `ochXXproduct_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `ochXXproduct_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
36 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `ochXXimage` i
             INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `ochXXimage_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
36 queries
SELECT `id_product_attribute`
            FROM `ochXXproduct_attribute`
            WHERE `id_product` = XX
36 queries
                SELECT `id_category` FROM `ochXXcategory_product`
                WHERE `id_product` = XX
36 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `ochXXiqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
36 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `ochXXproduct_attribute` pa
             INNER JOIN ochXXproduct_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `ochXXproduct_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `ochXXattribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `ochXXattribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
23 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `ochXXspecific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
23 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `ochXXspecific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
18 queries
SELECT *
FROM `ochXXcategory` a
LEFT JOIN `ochXXcategory_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `ochXXcategory_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
18 queries
SELECT `id_module` FROM `ochXXmodule_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
6 queries
			SELECT cl.`link_rewrite`
			FROM `ochXXcategory_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `ochXXattribute_group` ag INNER JOIN `ochXXattribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `ochXXattribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN ochXXattribute_group_shop attribute_group_shop
        ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX)  INNER JOIN ochXXattribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `ochXXlayered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
4 queries
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN ochXXattribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
3 queries
				SELECT `name`
				FROM `ochXXmanufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `ochXXmodule` m
                LEFT JOIN `ochXXmodule_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `ochXXlang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `ochXXcategory_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `ochXXmanufacturer` m INNER JOIN ochXXmanufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `ochXXmanufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN ochXXfeature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
2 queries
				SELECT tr.*
				FROM `ochXXtax_rule` tr
				JOIN `ochXXtax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT XX FROM `ochXXcart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

123 product
123 product_shop
88 product_attribute
74 cart_product
72 image
72 image_shop
72 product_attribute_shop
69 category_lang
65 specific_price
52 product_attribute_combination
52 category_product
49 stock_available
44 attribute
43 category
41 attribute_group
40 attribute_lang
38 feature_product
37 feature
37 feature_shop
37 feature_lang
37 product_lang
36 product_group_reduction_cache
36 pack
36 feature_value_lang
36 image_lang
36 iqitreviews_products
25 category_shop
23 specific_price_priority
22 module
21 module_shop
17 category_group
12 product_sale
7 hook
5 lang
5 currency
5 attribute_group_shop
5 attribute_group_lang
5 manufacturer
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 attribute_shop
4 layered_indexable_attribute_lang_value
3 country
3 hook_alias
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 manufacturer_shop
2 manufacturer_lang
2 tax_rule
2 tax_rules_group
2 iqit_elementor_category
2 cart_rule
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 layered_category
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 tax
1 tax_lang
1 feature_flag
1 iqit_elementor_category_shop
1 connections
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 62 /classes/Link.php:113 (__construct) [id: 747]
/classes/Link.php:113 (__construct) [id: 749]
/classes/Link.php:113 (__construct) [id: 770]
/classes/Link.php:113 (__construct) [id: 1620]
/classes/Link.php:113 (__construct) [id: 1494]
/classes/Link.php:113 (__construct) [id: 1485]
/classes/Link.php:113 (__construct) [id: 1506]
/classes/Link.php:113 (__construct) [id: 1607]
/classes/Link.php:113 (__construct) [id: 1537]
/classes/Link.php:113 (__construct) [id: 1608]
/classes/Link.php:113 (__construct) [id: 1496]
/classes/Link.php:113 (__construct) [id: 1521]
/classes/Link.php:113 (__construct) [id: 1486]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 701]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1314]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 747]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 749]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 770]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 783]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1814]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2662]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1620]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2473]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1308]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2434]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1313]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1494]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1310]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2474]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1485]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2521]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1304]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1316]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1305]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1306]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1307]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1233]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1538]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1506]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1186]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1187]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1607]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1537]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1543]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1608]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1496]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1521]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1556]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1486]
/classes/Link.php:113 (__construct) [id: 747]
/classes/Link.php:113 (__construct) [id: 749]
/classes/Link.php:113 (__construct) [id: 770]
/classes/Link.php:113 (__construct) [id: 1620]
/classes/Link.php:113 (__construct) [id: 1494]
/classes/Link.php:113 (__construct) [id: 1485]
/classes/Link.php:113 (__construct) [id: 1506]
/classes/Link.php:113 (__construct) [id: 1607]
/classes/Link.php:113 (__construct) [id: 1537]
/classes/Link.php:113 (__construct) [id: 1608]
/classes/Link.php:113 (__construct) [id: 1496]
/classes/Link.php:113 (__construct) [id: 1521]
/classes/Link.php:113 (__construct) [id: 1486]
Category 23 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 22]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 26]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 29]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 41]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 42]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 43]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 45]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 94]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 130]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 131]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 138]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 272]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 274]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 275]
/classes/Meta.php:379 (__construct) [id: 22]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 22]
/modules/ps_facetedsearch/src/Filters/Block.php:158 (__construct) [id: 22]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1768 (__construct) [id: 0]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Tax 1 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 31]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /classes/Smarty/SmartyDev.php
199 /vendor/smarty/smarty/libs/Smarty.class.php
200 /vendor/smarty/smarty/libs/functions.php
201 /vendor/smarty/smarty/libs/Autoloader.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
211 /config/smartyfront.config.inc.php
212 /classes/Smarty/SmartyResourceModule.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
215 /classes/Smarty/SmartyResourceParent.php
216 /classes/Smarty/SmartyLazyRegister.php
217 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
218 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
219 /classes/Customer.php
220 /classes/Group.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /classes/Dispatcher.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
231 /src/Adapter/SymfonyContainer.php
232 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
233 /src/Adapter/ContainerBuilder.php
234 /src/Adapter/Environment.php
235 /src/Core/EnvironmentInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
237 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
238 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
239 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
240 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
241 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
245 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
246 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
247 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
248 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
249 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
250 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
252 /vendor/symfony/contracts/Service/ResetInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
255 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
256 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
258 /vendor/symfony/contracts/Cache/ItemInterface.php
259 /vendor/psr/cache/src/CacheItemInterface.php
260 /vendor/psr/cache/src/CacheItemPoolInterface.php
261 /vendor/symfony/contracts/Cache/CacheInterface.php
262 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
264 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
266 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
267 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
268 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
269 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
270 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
271 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
319 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
321 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
323 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
324 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
325 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
326 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
330 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
331 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
332 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
333 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
334 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
335 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
336 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
337 /var/cache/dev/FrontContainer.php
338 /src/Adapter/Container/LegacyContainer.php
339 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
340 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
341 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
342 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
343 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
344 /vendor/psr/container/src/ContainerExceptionInterface.php
345 /vendor/psr/container/src/NotFoundExceptionInterface.php
346 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
347 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
348 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
349 /src/Adapter/Container/LegacyContainerInterface.php
350 /modules/blockwishlist/vendor/autoload.php
351 /modules/blockwishlist/vendor/composer/autoload_real.php
352 /modules/blockwishlist/vendor/composer/autoload_static.php
353 /modules/contactform/vendor/autoload.php
354 /modules/contactform/vendor/composer/autoload_real.php
355 /modules/contactform/vendor/composer/autoload_static.php
356 /modules/dashactivity/vendor/autoload.php
357 /modules/dashactivity/vendor/composer/autoload_real.php
358 /modules/dashactivity/vendor/composer/platform_check.php
359 /modules/dashactivity/vendor/composer/autoload_static.php
360 /modules/dashtrends/vendor/autoload.php
361 /modules/dashtrends/vendor/composer/autoload_real.php
362 /modules/dashtrends/vendor/composer/autoload_static.php
363 /modules/dashgoals/vendor/autoload.php
364 /modules/dashgoals/vendor/composer/autoload_real.php
365 /modules/dashgoals/vendor/composer/platform_check.php
366 /modules/dashgoals/vendor/composer/autoload_static.php
367 /modules/dashproducts/vendor/autoload.php
368 /modules/dashproducts/vendor/composer/autoload_real.php
369 /modules/dashproducts/vendor/composer/platform_check.php
370 /modules/dashproducts/vendor/composer/autoload_static.php
371 /modules/graphnvd3/vendor/autoload.php
372 /modules/graphnvd3/vendor/composer/autoload_real.php
373 /modules/graphnvd3/vendor/composer/autoload_static.php
374 /modules/gridhtml/vendor/autoload.php
375 /modules/gridhtml/vendor/composer/autoload_real.php
376 /modules/gridhtml/vendor/composer/autoload_static.php
377 /modules/gsitemap/vendor/autoload.php
378 /modules/gsitemap/vendor/composer/autoload_real.php
379 /modules/gsitemap/vendor/composer/platform_check.php
380 /modules/gsitemap/vendor/composer/autoload_static.php
381 /modules/pagesnotfound/vendor/autoload.php
382 /modules/pagesnotfound/vendor/composer/autoload_real.php
383 /modules/pagesnotfound/vendor/composer/platform_check.php
384 /modules/pagesnotfound/vendor/composer/autoload_static.php
385 /modules/productcomments/vendor/autoload.php
386 /modules/productcomments/vendor/composer/autoload_real.php
387 /modules/productcomments/vendor/composer/platform_check.php
388 /modules/productcomments/vendor/composer/autoload_static.php
389 /modules/ps_categorytree/vendor/autoload.php
390 /modules/ps_categorytree/vendor/composer/autoload_real.php
391 /modules/ps_categorytree/vendor/composer/platform_check.php
392 /modules/ps_categorytree/vendor/composer/autoload_static.php
393 /modules/ps_checkpayment/vendor/autoload.php
394 /modules/ps_checkpayment/vendor/composer/autoload_real.php
395 /modules/ps_checkpayment/vendor/composer/autoload_static.php
396 /modules/ps_crossselling/vendor/autoload.php
397 /modules/ps_crossselling/vendor/composer/autoload_real.php
398 /modules/ps_crossselling/vendor/composer/platform_check.php
399 /modules/ps_crossselling/vendor/composer/autoload_static.php
400 /modules/ps_currencyselector/vendor/autoload.php
401 /modules/ps_currencyselector/vendor/composer/autoload_real.php
402 /modules/ps_currencyselector/vendor/composer/autoload_static.php
403 /modules/ps_customeraccountlinks/vendor/autoload.php
404 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
405 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
406 /modules/ps_customersignin/vendor/autoload.php
407 /modules/ps_customersignin/vendor/composer/autoload_real.php
408 /modules/ps_customersignin/vendor/composer/autoload_static.php
409 /modules/ps_dataprivacy/vendor/autoload.php
410 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
411 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
412 /modules/ps_emailsubscription/vendor/autoload.php
413 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
414 /modules/ps_emailsubscription/vendor/composer/platform_check.php
415 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
416 /modules/ps_faviconnotificationbo/vendor/autoload.php
417 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
418 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
419 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
420 /modules/ps_languageselector/vendor/autoload.php
421 /modules/ps_languageselector/vendor/composer/autoload_real.php
422 /modules/ps_languageselector/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_wirepayment/vendor/autoload.php
430 /modules/ps_wirepayment/vendor/composer/autoload_real.php
431 /modules/ps_wirepayment/vendor/composer/platform_check.php
432 /modules/ps_wirepayment/vendor/composer/autoload_static.php
433 /modules/statsbestcategories/vendor/autoload.php
434 /modules/statsbestcategories/vendor/composer/autoload_real.php
435 /modules/statsbestcategories/vendor/composer/platform_check.php
436 /modules/statsbestcategories/vendor/composer/autoload_static.php
437 /modules/statsbestcustomers/vendor/autoload.php
438 /modules/statsbestcustomers/vendor/composer/autoload_real.php
439 /modules/statsbestcustomers/vendor/composer/platform_check.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestproducts/vendor/autoload.php
442 /modules/statsbestproducts/vendor/composer/autoload_real.php
443 /modules/statsbestproducts/vendor/composer/platform_check.php
444 /modules/statsbestproducts/vendor/composer/autoload_static.php
445 /modules/statsbestsuppliers/vendor/autoload.php
446 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
447 /modules/statsbestsuppliers/vendor/composer/platform_check.php
448 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
449 /modules/statsbestvouchers/vendor/autoload.php
450 /modules/statsbestvouchers/vendor/composer/autoload_real.php
451 /modules/statsbestvouchers/vendor/composer/platform_check.php
452 /modules/statsbestvouchers/vendor/composer/autoload_static.php
453 /modules/statscarrier/vendor/autoload.php
454 /modules/statscarrier/vendor/composer/autoload_real.php
455 /modules/statscarrier/vendor/composer/platform_check.php
456 /modules/statscarrier/vendor/composer/autoload_static.php
457 /modules/statscatalog/vendor/autoload.php
458 /modules/statscatalog/vendor/composer/autoload_real.php
459 /modules/statscatalog/vendor/composer/platform_check.php
460 /modules/statscatalog/vendor/composer/autoload_static.php
461 /modules/statscheckup/vendor/autoload.php
462 /modules/statscheckup/vendor/composer/autoload_real.php
463 /modules/statscheckup/vendor/composer/platform_check.php
464 /modules/statscheckup/vendor/composer/autoload_static.php
465 /modules/statsdata/vendor/autoload.php
466 /modules/statsdata/vendor/composer/autoload_real.php
467 /modules/statsdata/vendor/composer/autoload_static.php
468 /modules/statsforecast/vendor/autoload.php
469 /modules/statsforecast/vendor/composer/autoload_real.php
470 /modules/statsforecast/vendor/composer/platform_check.php
471 /modules/statsforecast/vendor/composer/autoload_static.php
472 /modules/statsnewsletter/vendor/autoload.php
473 /modules/statsnewsletter/vendor/composer/autoload_real.php
474 /modules/statsnewsletter/vendor/composer/platform_check.php
475 /modules/statsnewsletter/vendor/composer/autoload_static.php
476 /modules/statspersonalinfos/vendor/autoload.php
477 /modules/statspersonalinfos/vendor/composer/autoload_real.php
478 /modules/statspersonalinfos/vendor/composer/platform_check.php
479 /modules/statspersonalinfos/vendor/composer/autoload_static.php
480 /modules/statsproduct/vendor/autoload.php
481 /modules/statsproduct/vendor/composer/autoload_real.php
482 /modules/statsproduct/vendor/composer/platform_check.php
483 /modules/statsproduct/vendor/composer/autoload_static.php
484 /modules/statsregistrations/vendor/autoload.php
485 /modules/statsregistrations/vendor/composer/autoload_real.php
486 /modules/statsregistrations/vendor/composer/platform_check.php
487 /modules/statsregistrations/vendor/composer/autoload_static.php
488 /modules/statssales/vendor/autoload.php
489 /modules/statssales/vendor/composer/autoload_real.php
490 /modules/statssales/vendor/composer/platform_check.php
491 /modules/statssales/vendor/composer/autoload_static.php
492 /modules/statssearch/vendor/autoload.php
493 /modules/statssearch/vendor/composer/autoload_real.php
494 /modules/statssearch/vendor/composer/platform_check.php
495 /modules/statssearch/vendor/composer/autoload_static.php
496 /modules/statsstock/vendor/autoload.php
497 /modules/statsstock/vendor/composer/autoload_real.php
498 /modules/statsstock/vendor/composer/platform_check.php
499 /modules/statsstock/vendor/composer/autoload_static.php
500 /modules/psgdpr/vendor/autoload.php
501 /modules/psgdpr/vendor/composer/autoload_real.php
502 /modules/psgdpr/vendor/composer/autoload_static.php
503 /modules/ps_facetedsearch/vendor/autoload.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
505 /modules/ps_facetedsearch/vendor/composer/platform_check.php
506 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
507 /modules/iqitsociallogin/vendor/autoload.php
508 /modules/iqitsociallogin/vendor/composer/autoload_real.php
509 /modules/iqitsociallogin/vendor/composer/platform_check.php
510 /modules/iqitsociallogin/vendor/composer/autoload_static.php
511 /modules/ps_emailalerts/vendor/autoload.php
512 /modules/ps_emailalerts/vendor/composer/autoload_real.php
513 /modules/ps_emailalerts/vendor/composer/autoload_static.php
514 /modules/ps_googleanalytics/vendor/autoload.php
515 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
516 /modules/ps_googleanalytics/vendor/composer/platform_check.php
517 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
518 /modules/ph_simpleblog/vendor/autoload.php
519 /modules/ph_simpleblog/vendor/composer/autoload_real.php
520 /modules/ph_simpleblog/vendor/composer/platform_check.php
521 /modules/ph_simpleblog/vendor/composer/autoload_static.php
522 /modules/autoupgrade/vendor/autoload.php
523 /modules/autoupgrade/vendor/composer/autoload_real.php
524 /modules/autoupgrade/vendor/composer/autoload_static.php
525 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
526 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
527 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
528 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
529 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
530 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
531 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
532 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
533 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
534 /modules/iqitproductflags/vendor/autoload.php
535 /modules/iqitproductflags/vendor/composer/autoload_real.php
536 /modules/iqitproductflags/vendor/composer/platform_check.php
537 /modules/iqitproductflags/vendor/composer/autoload_static.php
538 /modules/iqitproductvariants/vendor/autoload.php
539 /modules/iqitproductvariants/vendor/composer/autoload_real.php
540 /modules/iqitproductvariants/vendor/composer/autoload_static.php
541 /src/Core/Hook/HookModuleFilter.php
542 /src/Core/Hook/HookModuleFilterInterface.php
543 /modules/ph_simpleblog/ph_simpleblog.php
544 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
545 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
546 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
547 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
548 /modules/ph_simpleblog/models/SimpleBlogCategory.php
549 /modules/ph_simpleblog/models/SimpleBlogPost.php
550 /modules/ph_simpleblog/models/SimpleBlogPostType.php
551 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
552 /modules/ph_simpleblog/models/SimpleBlogTag.php
553 /modules/ph_simpleblog/models/SimpleBlogComment.php
554 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
555 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
556 /modules/ph_simpleblog/classes/BlogPostsFinder.php
557 /modules/ph_simpleblog/controllers/front/default_list.php
558 /classes/controller/ModuleFrontController.php
559 /override/classes/controller/FrontController.php
560 /classes/controller/FrontController.php
561 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
562 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
563 /classes/Translate.php
564 /modules/ph_simpleblog/translations/es.php
565 /src/PrestaShopBundle/Translation/TranslatorComponent.php
566 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
567 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
568 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
569 /vendor/symfony/contracts/Translation/TranslatorInterface.php
570 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
571 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
572 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
573 /src/PrestaShopBundle/Translation/TranslatorInterface.php
574 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
575 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
576 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
577 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
578 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
579 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
580 /vendor/symfony/contracts/Translation/TranslatorTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
582 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
583 /var/cache/dev/translations/catalogue.es-ES.NXhscRe.php
584 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
585 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
587 /controllers/front/listing/CategoryController.php
588 /classes/controller/ProductListingFrontController.php
589 /classes/controller/ProductPresentingFrontController.php
590 /src/Adapter/Presenter/Object/ObjectPresenter.php
591 /src/Adapter/Presenter/PresenterInterface.php
592 /src/Adapter/Presenter/Cart/CartPresenter.php
593 /src/Adapter/Image/ImageRetriever.php
594 /classes/tax/TaxConfiguration.php
595 /classes/Smarty/TemplateFinder.php
596 /classes/assets/StylesheetManager.php
597 /classes/assets/AbstractAssetManager.php
598 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
599 /classes/assets/JavascriptManager.php
600 /classes/assets/CccReducer.php
601 /modules/iqitthemeeditor/iqitthemeeditor.php
602 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
603 /modules/iqitthemeeditor/translations/es.php
604 /classes/Category.php
605 /classes/webservice/WebserviceRequest.php
606 /src/Core/Localization/Locale/Repository.php
607 /src/Core/Localization/Locale/RepositoryInterface.php
608 /src/Core/Localization/CLDR/LocaleRepository.php
609 /src/Core/Localization/CLDR/LocaleDataSource.php
610 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
611 /src/Core/Data/Layer/AbstractDataLayer.php
612 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
613 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
614 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
615 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
616 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
617 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
618 /vendor/symfony/contracts/Cache/CacheTrait.php
619 /vendor/psr/cache/src/InvalidArgumentException.php
620 /vendor/psr/cache/src/CacheException.php
621 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
622 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
623 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
624 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
625 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
626 /src/Core/Localization/CLDR/Reader.php
627 /src/Core/Localization/CLDR/ReaderInterface.php
628 /src/Core/Localization/Currency/Repository.php
629 /src/Core/Localization/Currency/RepositoryInterface.php
630 /src/Core/Localization/Currency/CurrencyDataSource.php
631 /src/Core/Localization/Currency/DataSourceInterface.php
632 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
633 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
634 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
635 /src/Adapter/Currency/CurrencyDataProvider.php
636 /src/Core/Currency/CurrencyDataProviderInterface.php
637 /src/Adapter/LegacyContext.php
638 /src/Adapter/Tools.php
639 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
640 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
641 /vendor/prestashop/decimal/src/Operation/Rounding.php
642 /src/Core/Localization/Locale.php
643 /src/Core/Localization/LocaleInterface.php
644 /src/Core/Localization/Specification/Price.php
645 /src/Core/Localization/Specification/Number.php
646 /src/Core/Localization/Specification/NumberInterface.php
647 /src/Core/Localization/Specification/Factory.php
648 /src/Core/Localization/CLDR/LocaleData.php
649 /src/Core/Localization/CLDR/NumberSymbolsData.php
650 /src/Core/Localization/CLDR/CurrencyData.php
651 /src/Core/Localization/CLDR/Locale.php
652 /src/Core/Localization/CLDR/LocaleInterface.php
653 /src/Core/Localization/Specification/NumberSymbolList.php
654 /classes/Currency.php
655 /src/Core/Localization/Currency/LocalizedCurrencyId.php
656 /src/Core/Localization/Currency/CurrencyData.php
657 /src/Core/Localization/Currency/CurrencyCollection.php
658 /src/Core/Localization/Currency.php
659 /src/Core/Localization/CurrencyInterface.php
660 /src/Core/Localization/Specification/NumberCollection.php
661 /src/Core/Localization/Number/Formatter.php
662 /override/classes/Cart.php
663 /classes/Cart.php
664 /src/Adapter/AddressFactory.php
665 /override/classes/CartRule.php
666 /classes/CartRule.php
667 /classes/Product.php
668 /src/Core/Domain/Product/ValueObject/RedirectType.php
669 /src/Core/Util/DateTime/DateTime.php
670 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
671 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
672 /src/Core/Domain/Product/ValueObject/ProductType.php
673 /src/Core/Domain/Product/ValueObject/Reference.php
674 /src/Core/Domain/Product/ValueObject/Ean13.php
675 /src/Core/Domain/Product/ValueObject/Isbn.php
676 /src/Core/Domain/Product/ValueObject/Upc.php
677 /src/Core/Domain/Product/ProductSettings.php
678 /src/Core/Domain/Shop/ValueObject/ShopId.php
679 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
680 /modules/ps_emailsubscription/ps_emailsubscription.php
681 /src/Core/Module/WidgetInterface.php
682 /src/PrestaShopBundle/Translation/DomainNormalizer.php
683 /classes/Media.php
684 /modules/ps_emailalerts/ps_emailalerts.php
685 /modules/ps_emailalerts/MailAlert.php
686 /modules/iqitproductvariants/iqitproductvariants.php
687 /src/Adapter/Localization/LegacyTranslator.php
688 /src/Adapter/Presenter/Cart/CartLazyArray.php
689 /src/Adapter/Presenter/AbstractLazyArray.php
690 /src/Adapter/Product/PriceFormatter.php
691 /src/Core/Util/Inflector.php
692 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
693 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
694 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
695 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
696 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
697 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
698 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
699 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
700 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
701 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
702 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
703 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
704 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
705 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
706 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
707 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
708 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
709 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
710 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
711 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
712 /classes/Gender.php
713 /classes/Risk.php
714 /classes/Meta.php
715 /modules/revsliderprestashop/revsliderprestashop.php
716 /modules/revsliderprestashop/rev-loader.php
717 /modules/revsliderprestashop/includes/revslider_db.class.php
718 /modules/revsliderprestashop/includes/data.class.php
719 /modules/revsliderprestashop/includes/functions.class.php
720 /modules/revsliderprestashop/includes/em-integration.class.php
721 /modules/revsliderprestashop/includes/cssparser.class.php
722 /modules/revsliderprestashop/includes/woocommerce.class.php
723 /modules/revsliderprestashop/includes/wpml.class.php
724 /modules/revsliderprestashop/includes/colorpicker.class.php
725 /modules/revsliderprestashop/includes/navigation.class.php
726 /modules/revsliderprestashop/includes/object-library.class.php
727 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
728 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
729 /modules/revsliderprestashop/includes/extension.class.php
730 /modules/revsliderprestashop/includes/favorite.class.php
731 /modules/revsliderprestashop/includes/aq-resizer.class.php
732 /modules/revsliderprestashop/includes/external-sources.class.php
733 /modules/revsliderprestashop/includes/page-template.class.php
734 /modules/revsliderprestashop/includes/slider.class.php
735 /modules/revsliderprestashop/includes/slide.class.php
736 /modules/revsliderprestashop/includes/output.class.php
737 /modules/revsliderprestashop/public/revslider-front.class.php
738 /modules/revsliderprestashop/includes/backwards.php
739 /modules/revsliderprestashop/admin/includes/class-pclzip.php
740 /modules/revsliderprestashop/admin/includes/license.class.php
741 /modules/revsliderprestashop/admin/includes/addons.class.php
742 /modules/revsliderprestashop/admin/includes/template.class.php
743 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
744 /modules/revsliderprestashop/admin/includes/folder.class.php
745 /modules/revsliderprestashop/admin/includes/import.class.php
746 /modules/revsliderprestashop/admin/includes/export.class.php
747 /modules/revsliderprestashop/admin/includes/export-html.class.php
748 /modules/revsliderprestashop/admin/includes/newsletter.class.php
749 /modules/revsliderprestashop/admin/revslider-admin.class.php
750 /modules/revsliderprestashop/includes/update.class.php
751 /modules/revsliderprestashop/includes/resize-imag.php
752 /modules/revsliderprestashop/translations/es.php
753 /classes/Address.php
754 /classes/ImageType.php
755 /classes/State.php
756 /src/Core/Security/PasswordPolicyConfiguration.php
757 /src/Core/Configuration/DataConfigurationInterface.php
758 /src/Core/Filter/FrontEndObject/MainFilter.php
759 /src/Core/Filter/FilterInterface.php
760 /src/Core/Filter/FrontEndObject/CartFilter.php
761 /src/Core/Filter/HashMapWhitelistFilter.php
762 /src/Core/Filter/CollectionFilter.php
763 /src/Core/Filter/FrontEndObject/ProductFilter.php
764 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
765 /src/Core/Filter/FrontEndObject/CustomerFilter.php
766 /src/Core/Filter/FrontEndObject/ShopFilter.php
767 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
768 /modules/productcomments/productcomments.php
769 /modules/ps_shoppingcart/ps_shoppingcart.php
770 /modules/iqitcontactpage/iqitcontactpage.php
771 /modules/iqitcontactpage/translations/es.php
772 /modules/iqitcookielaw/iqitcookielaw.php
773 /modules/iqitcookielaw/translations/es.php
774 /modules/iqitcountdown/iqitcountdown.php
775 /modules/iqitcountdown/translations/es.php
776 /modules/iqitsociallogin/iqitsociallogin.php
777 /modules/iqitsociallogin/translations/es.php
778 /modules/ps_googleanalytics/ps_googleanalytics.php
779 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
780 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
781 /classes/Smarty/SmartyDevTemplate.php
782 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
783 /var/cache/dev/smarty/compile/warehouse/7f/93/a7/7f93a70bcc26a0e15d5a8f0ad7b21b4b42ad15c2_2.file.ps_googleanalytics.tpl.php
784 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
785 /classes/assets/PrestashopAssetsLibraries.php
786 /modules/iqitsizecharts/iqitsizecharts.php
787 /modules/iqitsizecharts/src/IqitSizeCharts.php
788 /modules/iqitsizecharts/translations/es.php
789 /modules/iqitwishlist/iqitwishlist.php
790 /modules/iqitwishlist/src/IqitWishlistProduct.php
791 /modules/iqitwishlist/translations/es.php
792 /modules/iqitreviews/iqitreviews.php
793 /modules/iqitreviews/src/IqitProductReview.php
794 /modules/iqitreviews/translations/es.php
795 /modules/iqitpopup/iqitpopup.php
796 /modules/iqitpopup/translations/es.php
797 /modules/iqitmegamenu/iqitmegamenu.php
798 /modules/iqitmegamenu/models/IqitMenuTab.php
799 /modules/iqitmegamenu/models/IqitMenuHtml.php
800 /modules/iqitmegamenu/models/IqitMenuLinks.php
801 /modules/iqitmegamenu/translations/es.php
802 /modules/iqitcompare/iqitcompare.php
803 /modules/iqitcompare/translations/es.php
804 /modules/iqitelementor/iqitelementor.php
805 /modules/iqitelementor/src/IqitElementorLanding.php
806 /modules/iqitelementor/src/IqitElementorTemplate.php
807 /modules/iqitelementor/src/IqitElementorProduct.php
808 /modules/iqitelementor/src/IqitElementorCategory.php
809 /modules/iqitelementor/src/IqitElementorContent.php
810 /modules/iqitelementor/src/iqitElementorWpHelper.php
811 /modules/iqitelementor/includes/plugin-elementor.php
812 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
813 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
814 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
815 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
816 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
817 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
818 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
819 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
820 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
821 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
822 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
823 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
824 /modules/iqitelementor/translations/es.php
825 /modules/iqitextendedproduct/iqitextendedproduct.php
826 /modules/iqitextendedproduct/src/IqitThreeSixty.php
827 /modules/iqitextendedproduct/src/IqitProductVideo.php
828 /modules/iqitextendedproduct/translations/es.php
829 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
830 /modules/iqitfreedeliverycount/translations/es.php
831 /src/Core/Product/Search/ProductSearchContext.php
832 /src/Core/Product/Search/ProductSearchQuery.php
833 /src/Core/Product/Search/SortOrder.php
834 /modules/ps_facetedsearch/ps_facetedsearch.php
835 /modules/ps_facetedsearch/src/HookDispatcher.php
836 /modules/ps_facetedsearch/src/Hook/Attribute.php
837 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
838 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
839 /modules/ps_facetedsearch/src/Hook/Category.php
840 /modules/ps_facetedsearch/src/Hook/Configuration.php
841 /modules/ps_facetedsearch/src/Hook/Design.php
842 /modules/ps_facetedsearch/src/Hook/Feature.php
843 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
844 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
845 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
846 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
847 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
848 /modules/ps_facetedsearch/src/Hook/Product.php
849 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
850 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
851 /modules/ps_facetedsearch/src/Filters/Provider.php
852 /modules/ps_facetedsearch/src/URLSerializer.php
853 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
854 /modules/ps_facetedsearch/src/Product/SearchProvider.php
855 /src/Core/Product/Search/FacetsRendererInterface.php
856 /src/Core/Product/Search/ProductSearchProviderInterface.php
857 /modules/ps_facetedsearch/src/Filters/Converter.php
858 /modules/ps_facetedsearch/src/Product/SearchFactory.php
859 /src/Core/Product/Search/ProductSearchResult.php
860 /classes/Combination.php
861 /classes/Manufacturer.php
862 /src/Core/Util/String/StringModifier.php
863 /src/Core/Util/String/StringModifierInterface.php
864 /modules/ps_facetedsearch/src/Product/Search.php
865 /modules/ps_facetedsearch/src/Adapter/MySQL.php
866 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
867 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
868 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
869 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
870 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
871 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
872 /modules/ps_facetedsearch/src/Filters/Products.php
873 /classes/stock/StockAvailable.php
874 /modules/ps_facetedsearch/src/Filters/Block.php
875 /src/Core/Product/Search/Facet.php
876 /src/Core/Product/Search/Filter.php
877 /vendor/prestashop/decimal/src/DecimalNumber.php
878 /vendor/prestashop/decimal/src/Builder.php
879 /src/Core/Product/Search/FacetCollection.php
880 /classes/ProductAssembler.php
881 /classes/tax/Tax.php
882 /classes/SpecificPrice.php
883 /classes/tax/TaxManagerFactory.php
884 /classes/tax/TaxRulesTaxManager.php
885 /classes/tax/TaxManagerInterface.php
886 /classes/tax/TaxCalculator.php
887 /classes/GroupReduction.php
888 /src/Core/Localization/CLDR/ComputingPrecision.php
889 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
890 /classes/Pack.php
891 /classes/order/Order.php
892 /classes/Feature.php
893 /classes/ProductPresenterFactory.php
894 /src/Adapter/Presenter/Product/ProductListingPresenter.php
895 /src/Adapter/Presenter/Product/ProductPresenter.php
896 /src/Adapter/Product/ProductColorsRetriever.php
897 /src/Adapter/HookManager.php
898 /src/Core/Product/ProductPresentationSettings.php
899 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
900 /src/Adapter/Presenter/Product/ProductLazyArray.php
901 /classes/Image.php
902 /src/Core/Image/ImageFormatConfiguration.php
903 /src/Core/Image/ImageFormatConfigurationInterface.php
904 /classes/FeatureFlag.php
905 /src/Core/FeatureFlag/FeatureFlagSettings.php
906 /classes/ImageManager.php
907 /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
908 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
909 /vendor/smarty/smarty/libs/plugins/modifier.count.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
912 /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
913 /src/Core/Product/Search/Pagination.php
914 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/a2/ac/10a2acb40a62faa7d4acf2ff79326cb9143364b9_2.file.category.tpl.php
915 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
916 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/7b/44/3b7b442e5be09f725564779ed89a7b73454120cc_2.file.product-list.tpl.php
917 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7b/05/e6/7b05e63eca4eeeca1407af0182fcc5f72eca6296_2.file.layout-left-column.tpl.php
918 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/dd/6f/fedd6f2f1c5383ca8f7a88001e645ec51798686f_2.file.layout-both-columns.tpl.php
919 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9f/7e/4a/9f7e4a2a31953c1ffd9af92c83bd91c1f3cd2c35_2.file.helpers.tpl.php
920 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
921 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/44/bf/b0/44bfb034c1f795379c422b7f1f9e16fbdd438c93_2.file.head.tpl.php
922 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/74/6f/a3/746fa3dd2b21e5f8274bb1f50aedff4595bb552e_2.file.head-jsonld.tpl.php
923 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/8d/80/d08d80bb870efd73dd55124817cbf5d770e7f7b2_2.file.product-list-jsonld.tpl.php
924 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/56/86/bf/5686bf9c07020fd395790a361d8976132a2fc4be_2.file.pagination-seo.tpl.php
925 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
926 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
927 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/93/e8/ed/93e8edeadb416f4f6abcf2d2b76fb0f54d0eba3d_2.file.stylesheets.tpl.php
928 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/af/76/c2af76b01726147ed1ded7543d0fd920339756bf_2.file.javascript.tpl.php
929 /classes/ProductDownload.php
930 /src/Core/Cart/Calculator.php
931 /src/Core/Cart/CartRowCollection.php
932 /src/Core/Cart/Fees.php
933 /src/Core/Cart/AmountImmutable.php
934 /src/Core/Cart/CartRuleCollection.php
935 /src/Core/Cart/CartRuleCalculator.php
936 /src/Adapter/Product/PriceCalculator.php
937 /src/Core/Cart/CartRow.php
938 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
939 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/0d/00/3b0d00bced40dc74d264c896b3629516dca0a06b_2.file.product-activation.tpl.php
940 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/2a/1d/d02a1d5aa2fc8a2b372e76425c1d49b597137881_2.file.header.tpl.php
941 /modules/iqitlinksmanager/iqitlinksmanager.php
942 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
943 /modules/iqitlinksmanager/src/IqitLinkBlock.php
944 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
945 /modules/iqitlinksmanager/translations/es.php
946 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
947 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
948 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
949 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
950 /modules/iqithtmlandbanners/iqithtmlandbanners.php
951 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
952 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
953 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
954 /modules/iqithtmlandbanners/translations/es.php
955 /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/6/displayNav1/warehouse/64/b3/a0/64b3a05a92755470dbe68e15850e9db18a22e46f.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
956 /modules/ps_languageselector/ps_languageselector.php
957 /modules/ps_currencyselector/ps_currencyselector.php
958 /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
959 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/54/66/f65466132945e631eb8304d318e35f83d75d651e_2.file.header-2.tpl.php
960 /modules/iqitsearch/iqitsearch.php
961 /modules/iqitsearch/translations/es.php
962 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
963 /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
964 /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
965 /modules/ps_customersignin/ps_customersignin.php
966 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
967 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
968 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
969 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
970 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/a0/a9/c9/a0a9c936f74308bdc1809002e948b8c26b0f5101.iqitmegamenuviewstemplateshookhorizontal.tpl.php
971 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/32/0c/d5/320cd56ae00cdb0df3cfaafda14dd79eef879159_2.file.mobile-header-2.tpl.php
972 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
973 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
974 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
975 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/88/01/f3/8801f3aef6612da9973e6f09844670ad2455b33c_2.file.breadcrumb.tpl.php
976 /modules/iqitproductsnav/iqitproductsnav.php
977 /modules/iqitproductsnav/translations/es.php
978 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/50/cf/2150cf9c7d24917c3322283d8d2a9798a55f33e1_2.file.notifications.tpl.php
979 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/39/dd/35/39dd3579b0d411714a13183f74f90657d9b16218_2.file.category-header.tpl.php
980 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/dc/dd/42/dcdd424ea5bdc2c731edea74e82e1b9752018d7f_2.file.products-top.tpl.php
981 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
982 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/f8/f7/e0f8f73bf2628e2a1784900d2234f9911a72566f_2.file.sort-orders.tpl.php
983 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/01/2d/6a/012d6af2272aef31c4959b70cb660dbba790eea4_2.file.pagination.tpl.php
984 /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
985 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e1/47/0e/e1470e491391572ac54700f0cafe332fed74977f_2.file.products.tpl.php
986 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/df/f3/21dff30aa3f82bc080b677e35ebedc1ec9a53690_2.file.product.tpl.php
987 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b2/b6/ab/b2b6ab658128da2281b45debedef04ba4285e0d8_2.file.product-miniature-1.tpl.php
988 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/70/ad/8b/70ad8bf895d617e9f5f73f4ce8c2c56d5c17c215_2.file.product-miniature-thumb.tpl.php
989 /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
990 /var/cache/dev/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
991 /modules/iqitproductflags/iqitproductflags.php
992 /src/Adapter/ContainerFinder.php
993 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php
994 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php
995 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php
996 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php
997 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php
998 /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php
999 /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php
1000 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php
1001 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php
1002 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php
1003 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php
1004 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php
1005 /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php
1006 /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php
1007 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php
1008 /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php
1009 /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php
1010 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php
1011 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php
1012 /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php
1013 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php
1014 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php
1015 /vendor/doctrine/persistence/src/Persistence/ObjectManager.php
1016 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php
1017 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php
1018 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php
1019 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php
1020 /vendor/doctrine/doctrine-bundle/ConnectionFactory.php
1021 /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php
1022 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php
1023 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php
1024 /vendor/doctrine/event-manager/src/EventManager.php
1025 /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php
1026 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php
1027 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php
1028 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php
1029 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php
1030 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php
1031 /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php
1032 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php
1033 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php
1034 /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php
1035 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php
1036 /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php
1037 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php
1038 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php
1039 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php
1040 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php
1041 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php
1042 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php
1043 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php
1044 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php
1045 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php
1046 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php
1047 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php
1048 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php
1049 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL80Platform.php
1050 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL57Platform.php
1051 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php
1052 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php
1053 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php
1054 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php
1055 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php
1056 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php
1057 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php
1058 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php
1059 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php
1060 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php
1061 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php
1062 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php
1063 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php
1064 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php
1065 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php
1066 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php
1067 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php
1068 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php
1069 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php
1070 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php
1071 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php
1072 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php
1073 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php
1074 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php
1075 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php
1076 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php
1077 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php
1078 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php
1079 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php
1080 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php
1081 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php
1082 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php
1083 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php
1084 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php
1085 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php
1086 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php
1087 /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php
1088 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php
1089 /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php
1090 /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php
1091 /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php
1092 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php
1093 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php
1094 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php
1095 /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php
1096 /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php
1097 /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php
1098 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php
1099 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php
1100 /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php
1101 /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php
1102 /vendor/doctrine/persistence/src/Persistence/Proxy.php
1103 /modules/iqitproductflags/src/Entity/IqitProductFlag.php
1104 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php
1105 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php
1106 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php
1107 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php
1108 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php
1109 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php
1110 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php
1111 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php
1112 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php
1113 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php
1114 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php
1115 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php
1116 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php
1117 /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php
1118 /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php
1119 /src/PrestaShopBundle/Entity/Shop.php
1120 /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php
1121 /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php
1122 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php
1123 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php
1124 /modules/iqitproductflags/src/Repository/FlagRepository.php
1125 /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php
1126 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php
1127 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php
1128 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php
1129 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php
1130 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php
1131 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php
1132 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php
1133 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php
1134 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php
1135 /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php
1136 /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php
1137 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php
1138 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php
1139 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php
1140 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php
1141 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php
1142 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php
1143 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php
1144 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php
1145 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php
1146 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php
1147 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php
1148 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php
1149 /src/PrestaShopBundle/Entity/Lang.php
1150 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php
1151 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php
1152 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php
1153 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php
1154 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php
1155 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php
1156 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php
1157 /src/PrestaShopBundle/Entity/ShopGroup.php
1158 /src/PrestaShopBundle/Entity/ShopUrl.php
1159 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php
1160 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php
1161 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php
1162 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php
1163 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php
1164 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php
1165 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php
1166 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php
1167 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php
1168 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php
1169 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php
1170 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php
1171 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php
1172 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php
1173 /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php
1174 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php
1175 /src/PrestaShopBundle/Entity/Translation.php
1176 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php
1177 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php
1178 /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php
1179 /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php
1180 /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php
1181 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php
1182 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php
1183 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php
1184 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php
1185 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php
1186 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php
1187 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php
1188 /modules/iqitproductflags/src/Presenter/FlagPresenter.php
1189 /var/cache/dev/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php
1190 /var/cache/dev/smarty/compile/warehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1191 /vendor/smarty/smarty/libs/plugins/function.math.php
1192 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/75/b9/97/75b997bec85704ff1d7a8fb47417253a50e7be32_2.file.product-miniature-btn.tpl.php
1193 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/50/d2/88/50d288732d70e59ef94f3875a561157d73c09f9e_2.file.products-bottom.tpl.php
1194 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/ce/84/ea/ce84eadc655e6b98707bc940129b94e0b7569370_2.file.category-footer.tpl.php
1195 /modules/ps_categorytree/ps_categorytree.php
1196 /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1197 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/3a/47/3e3a47dc2c5a5d8e5e109d269aa58f1349bf3548_2.file.footer.tpl.php
1198 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e6/9f/81/e69f8156b2319dff0e9edb2994d7f3cbefe774c5_2.file.footer-2.tpl.php
1199 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1200 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/6/warehouse/1d/83/01/1d8301bd7699d773c48e9ed487e5b638a51c9c67.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1201 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/00/82/b5/0082b5f5ed9b849deb993e6b9ea0688ca3375d26_2.file.footer-copyrights-1.tpl.php
1202 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e7/73/6b/e7736b26e5e94f428f828dbc3573ce171a95c436_2.file.password-policy-template.tpl.php
1203 /classes/form/CustomerLoginForm.php
1204 /classes/form/AbstractForm.php
1205 /classes/form/FormInterface.php
1206 /src/Core/Foundation/Templating/RenderableInterface.php
1207 /classes/form/CustomerLoginFormatter.php
1208 /classes/form/FormFormatterInterface.php
1209 /classes/ValidateConstraintTranslator.php
1210 /src/Core/Util/InternationalizedDomainNameConverter.php
1211 /src/Core/Foundation/Templating/RenderableProxy.php
1212 /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1213 /classes/form/FormField.php
1214 /var/cache/dev/smarty/compile/warehouse/f2/1e/55/f21e55894ac1dca3333e5ff490219e193d3a69c6_2.file.login-form.tpl.php
1215 /var/cache/dev/smarty/compile/warehouse/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1216 /var/cache/dev/smarty/compile/d2/95/88/d29588162f18c1514f5b17d42ceef7eee6820be1_2.file.form-fields.tpl.php
1217 /var/cache/dev/smarty/compile/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1218 /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/6/warehouse/60/1e/f4/601ef4a2f7dca2c97f8f1a899dc64be4a2331ab8.iqitsocialloginviewstemplateshookauthentication.tpl.php
1219 /var/cache/dev/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1220 /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/02/05/98/020598f14f8b3a756a608f01492a41ebd60e5afd.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1221 /modules/statsdata/statsdata.php
1222 /classes/Connection.php
1223 /classes/ConnectionsSource.php
1224 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1225 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1226 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1227 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1228 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1229 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1230 /var/cache/dev/smarty/compile/warehouse/0b/04/d5/0b04d5d296cc40e94fc50a82355434090632a0d7_2.file.ga_tag.tpl.php