FACIAL

Cosmética facial 

Cuida tu piel con nuestra dermocosmética facial

Mostrando 1-36 de 40 artículo(s)
Producto añadido
Producto añadido a Comparar

Este sitio web utiliza cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Para dar su consentimiento sobre su uso pulse el botón Acepto.

Load Time 727.007 ms
Querying Time 353 ms
Queries 730
Memory Peak Usage 64.9 Mb
Included Files 1227 files - 12.70 Mb
PrestaShop Cache - Mb
Global vars 0.05 Mb
PrestaShop Version 8.2.7
PHP Version 8.4.10
MySQL Version 8.0.45-36
Memory Limit 512M
Max Execution Time 165s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 94.452 ms 94.452 ms 18.40 Mb 19.6 Mb
__construct 0.012 ms 94.464 ms - Mb 19.6 Mb
init 42.101 ms 136.565 ms 5.29 Mb 24.7 Mb
checkAccess 0.002 ms 136.567 ms - Mb 24.7 Mb
setMedia 5.519 ms 142.086 ms 0.79 Mb 24.7 Mb
postProcess 0.002 ms 142.088 ms - Mb 24.7 Mb
initHeader 0.003 ms 142.091 ms - Mb 24.7 Mb
initContent 355.458 ms 497.549 ms 23.89 Mb 48.4 Mb
initFooter 0.002 ms 497.551 ms - Mb 48.4 Mb
display 229.456 ms 727.007 ms 15.36 Mb 64.9 Mb
Hook Time Memory Usage
DisplayProductCampagains 101.321 ms 6.61 Mb
displayProductListReviews 26.814 ms 1.40 Mb
displayProductListFunctionalButtons 12.899 ms 0.09 Mb
DisplayBeforeBodyClosingTag 5.952 ms 0.32 Mb
displayBeforeBodyClosingTag 5.244 ms 0.81 Mb
displayNav2 4.101 ms 0.18 Mb
displayLeftColumn 3.568 ms 0.23 Mb
DisplayHeader 3.122 ms 0.18 Mb
renderWidget 2.469 ms 0.20 Mb
displayNav1 2.318 ms 0.21 Mb
ProductSearchProvider 1.423 ms 0.20 Mb
displayTop 1.334 ms 0.12 Mb
displayMainMenu 1.274 ms 0.20 Mb
displayCategoryElementor 1.130 ms 0.08 Mb
displayFooter 1.043 ms 0.10 Mb
displayAfterBreadcrumb 1.035 ms 0.04 Mb
ActionFrontControllerSetMedia 1.007 ms 0.13 Mb
displayCustomerLoginFormAfter 0.906 ms 0.07 Mb
IsJustElementor 0.619 ms 0.02 Mb
DisplayLeftColumn 0.214 ms 0.08 Mb
OverrideLayoutTemplate 0.040 ms - Mb
ModuleRoutes 0.007 ms - Mb
displayVerticalMenu 0.007 ms - Mb
ActionDispatcher 0.005 ms - Mb
ActionProductSearchAfter 0.005 ms - Mb
25 hook(s) 177.857 ms 11.27 Mb
Module Time Memory Usage
ph_simpleblog 12.232 ms 3.30 Mb
iqitthemeeditor 2.514 ms 0.54 Mb
ps_emailsubscription 2.734 ms 0.37 Mb
ps_emailalerts 1.760 ms 0.29 Mb
iqitproductvariants 0.449 ms 0.04 Mb
revsliderprestashop 38.398 ms 7.98 Mb
productcomments 1.413 ms 0.28 Mb
ps_shoppingcart 1.646 ms 0.17 Mb
iqitcontactpage 1.264 ms 0.12 Mb
iqitcookielaw 1.130 ms 0.11 Mb
iqitcountdown 0.206 ms 0.03 Mb
iqitsociallogin 1.242 ms 0.14 Mb
ps_googleanalytics 3.969 ms 0.36 Mb
iqitsizecharts 1.035 ms 0.26 Mb
iqitwishlist 12.786 ms 0.95 Mb
iqitreviews 27.324 ms 1.51 Mb
iqitpopup 1.133 ms 0.15 Mb
iqitmegamenu 4.762 ms 1.06 Mb
iqitcompare 7.179 ms 0.16 Mb
iqitelementor 6.126 ms 1.07 Mb
iqitextendedproduct 0.827 ms 0.16 Mb
iqitfreedeliverycount 0.360 ms 0.06 Mb
ps_facetedsearch 5.581 ms 0.91 Mb
iqitlinksmanager 3.245 ms 0.38 Mb
ps_languageselector 1.244 ms 0.07 Mb
ps_currencyselector 1.078 ms 0.07 Mb
iqitsearch 1.652 ms 0.12 Mb
ps_customersignin 0.131 ms 0.03 Mb
iqitproductsnav 1.257 ms 0.07 Mb
iqitproductflags 101.717 ms 6.74 Mb
ps_categorytree 3.948 ms 0.30 Mb
statsdata 3.342 ms 0.16 Mb
32 module(s) 253.684 ms 27.97 Mb

Stopwatch SQL - 730 queries

# Query Time (ms) Rows Filesort Group By Location
83 
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p GROUP BY p.id_manufacturer
 26.799 ms 39950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `och438configuration` c
LEFT JOIN `och438configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 3.785 ms 1327 /classes/Configuration.php:180
75 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=3 AND c.nleft>7 AND c.nright<40 GROUP BY cp.id_category
 3.527 ms 432 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
72 
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
 3.335 ms 432 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
92 
REPLACE INTO och438layered_filter_block (hash, data) VALUES ("980ca526b4809d5419323dd6b4053dd3", "a:1:{s:7:\"filters\";a:4:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:9:{i:26;a:2:{s:4:\"name\";s:11:\"LIMPIADORES\";s:3:\"nbr\";s:2:\"11\";}i:29;a:2:{s:4:\"name\";s:5:\"SERUM\";s:3:\"nbr\";s:1:\"8\";}i:33;a:2:{s:4:\"name\";s:16:\"CONTORNO DE OJOS\";s:3:\"nbr\";s:1:\"4\";}i:41;a:2:{s:4:\"name\";s:11:\"MASCARILLAS\";s:3:\"nbr\";s:1:\"5\";}i:42;a:2:{s:4:\"name\";s:8:\"TÓNICOS\";s:3:\"nbr\";s:1:\"1\";}i:44;a:2:{s:4:\"name\";s:6:\"CREMAS\";s:3:\"nbr\";s:1:\"5\";}i:45;a:2:{s:4:\"name\";s:8:\"ESENCIAS\";s:3:\"nbr\";s:1:\"2\";}i:130;a:2:{s:4:\"name\";s:17:\"COSMETICA COREANA\";s:3:\"nbr\";s:2:\"13\";}i:131;a:2:{s:4:\"name\";s:16:\"POTENCIA TU GLOW\";s:3:\"nbr\";s:1:\"1\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:38:{i:3;a:2:{s:4:\"name\";s:5:\"ISDIN\";s:3:\"nbr\";s:1:\"8\";}i:5;a:2:{s:4:\"name\";s:14:\"Cantabria Labs\";s:3:\"nbr\";s:1:\"1\";}i:6;a:3:{s:4:\"name\";s:6:\"Cerave\";s:3:\"nbr\";s:2:\"22\";s:7:\"checked\";b:1;}i:7;a:2:{s:4:\"name\";s:3:\"SVR\";s:3:\"nbr\";s:1:\"1\";}i:11;a:2:{s:4:\"name\";s:14:\"LA ROCHE POSAY\";s:3:\"nbr\";s:2:\"19\";}i:12;a:2:{s:4:\"name\";s:11:\"IFCANTABRIA\";s:3:\"nbr\";s:2:\"54\";}i:13;a:2:{s:4:\"name\";s:15:\"LAB SVR ESPAÑA\";s:3:\"nbr\";s:2:\"68\";}i:14;a:2:{s:4:\"name\";s:13:\"SKINCEUTICALS\";s:3:\"nbr\";s:2:\"32\";}i:22;a:2:{s:4:\"name\";s:18:\"LETI PHARMA S.L.U.\";s:3:\"nbr\";s:1:\"3\";}i:57;a:2:{s:4:\"name\";s:11:\"ARTURO ALBA\";s:3:\"nbr\";s:2:\"23\";}i:58;a:2:{s:4:\"name\";s:8:\"ERBORIAN\";s:3:\"nbr\";s:2:\"20\";}i:59;a:2:{s:4:\"name\";s:13:\"Moncho moreno\";s:3:\"nbr\";s:1:\"1\";}i:61;a:2:{s:4:\"name\";s:3:\"TWO\";s:3:\"nbr\";s:2:\"20\";}i:62;a:2:{s:4:\"name\";s:15:\"IVB Welness lab\";s:3:\"nbr\";s:1:\"1\";}i:67;a:2:{s:4:\"name\";s:22:\"L´occitane (erborian)\";s:3:\"nbr\";s:2:\"58\";}i:68;a:2:{s:4:\"name\";s:18:\"GEMA HERRERIA S.LU\";s:3:\"nbr\";s:2:\"33\";}i:70;a:3:{s:4:\"name\";s:19:\"MIIN COSMETICS S.L.\";s:3:\"nbr\";s:2:\"11\";s:7:\"checked\";b:1;}i:87;a:2:{s:4:\"name\";s:7:\"OZOAQUA\";s:3:\"nbr\";s:1:\"1\";}i:93;a:2:{s:4:\"name\";s:16:\"BEAUTY OF JOSEON\";s:3:\"nbr\";s:2:\"24\";}i:94;a:2:{s:4:\"name\";s:6:\"TOCOBO\";s:3:\"nbr\";s:1:\"9\";}i:99;a:2:{s:4:\"name\";s:6:\"BIODES\";s:3:\"nbr\";s:1:\"5\";}i:100;a:3:{s:4:\"name\";s:12:\"CANTABRIA PH\";s:3:\"nbr\";s:1:\"3\";s:7:\"checked\";b:1;}i:112;a:2:{s:4:\"name\";s:6:\"d\'Alba\";s:3:\"nbr\";s:1:\"6\";}i:113;a:2:{s:4:\"name\";s:15:\"haruharu wonder\";s:3:\"nbr\";s:1:\"2\";}i:114;a:2:{s:4:\"name\";s:8:\"Dr.Jart+\";s:3:\"nbr\";s:1:\"3\";}i:115;a:2:{s:4:\"name\";s:8:\"MEDICUBE\";s:3:\"nbr\";s:2:\"23\";}i:116;a:2:{s:4:\"name\";s:32:\"ESPAÑOLA DE NUEVOS TRATAMIENTOS\";s:3:\"nbr\";s:1:\"6\";}i:117;a:2:{s:4:\"name\";s:6:\"MISSHA\";s:3:\"nbr\";s:1:\"5\";}i:119;a:2:{s:4:\"name\";s:6:\"TIRTIR\";s:3:\"nbr\";s:1:\"6\";}i:120;a:2:{s:4:\"name\";s:10:\"Dr. Althea\";s:3:\"nbr\";s:1:\"1\";}i:121;a:2:{s:4:\"name\";s:13:\"UNICSKIN S.L.\";s:3:\"nbr\";s:1:\"2\";}i:122;a:2:{s:4:\"name\";s:19:\"ALTA COMESTICA S.L.\";s:3:\"nbr\";s:1:\"1\";}i:123;a:2:{s:4:\"name\";s:4:\"FIMO\";s:3:\"nbr\";s:1:\"1\";}i:124;a:2:{s:4:\"name\";s:42:\"ASOCIACION ESPAÑOLA DE PKAN ISBEL HEREDIA\";s:3:\"nbr\";s:1:\"1\";}i:125;a:2:{s:4:\"name\";s:4:\"ANUA\";s:3:\"nbr\";s:1:\"4\";}i:126;a:3:{s:4:\"name\";s:12:\"VT COSMETICS\";s:3:\"nbr\";s:1:\"3\";s:7:\"checked\";b:1;}i:127;a:3:{s:4:\"name\";s:12:\"BIOCOSMETICS\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:128;a:2:{s:4:\"name\";s:8:\"ASIN FCA\";s:3:\"nbr\";s:1:\"2\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:95;s:3:\"min\";d:3;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:40;s:5:\"value\";N;}i:3;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Selecciones\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:9:\"En oferta\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:5:\"Nuevo\";s:3:\"nbr\";i:1;}s:8:\"discount\";a:2:{s:4:\"name\";s:13:\"Con descuento\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
 2.527 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:210
727 
INSERT INTO `och438connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('198827', '', 'farmacialanueva.online/22-facial?q=Marca-BIOCOSMETICS-Cerave-MIIN+COSMETICS+S.L.-VT+COSMETICS-CANTABRIA+PH&resultsPerPage=36', '', '2026-06-22 19:57:42')
 2.064 ms 1 /classes/ObjectModel.php:622
703 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 1.837 ms 1 Yes Yes /classes/Product.php:4513
14 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `och438module` m
INNER JOIN och438module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `och438hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `och438hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `och438module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 1.798 ms 1560 Yes Yes /classes/Hook.php:1289
16 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook`
 1.621 ms 1143 /classes/Hook.php:1348
103 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `och438hook_module` hm
STRAIGHT_JOIN `och438hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `och438module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 1.569 ms 524 /classes/Hook.php:455
102 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `och438hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `och438hook_alias` ha
INNER JOIN `och438hook` h ON ha.name = h.name
 1.513 ms 0 /classes/Hook.php:1348
77 
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute
 1.462 ms 216 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
79 
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute
 1.437 ms 216 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
69 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
 1.416 ms 129 Yes /classes/Manufacturer.php:201
91 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 6) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-06-22 19:57:41' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-06-22 19:57:41' <= sp.to) 
) WHERE ((sp.reduction>0))
 1.389 ms 216 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
82 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
 1.323 ms 129 Yes /classes/Manufacturer.php:201
37 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `och438category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 22
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 1.294 ms 61 Yes Yes /classes/Category.php:916
89 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE ((p.on_sale=1))
 1.264 ms 216 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
13 
SELECT SQL_NO_CACHE lower(name) as name
FROM `och438hook` h
WHERE (h.active = 1)
 1.231 ms 1143 /classes/Hook.php:1388
93 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-06-22 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM och438product p
LEFT JOIN och438product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN och438stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN och438product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (690,693,1717,718,2429,2427,2428,2433,756,2662,1168,2521,1658,1285,1374,1718,1719,1335,1709,1866,1867,1939,1973,1974,1994,2005,2007,2320,2321,2349,2497,2498,2499,2500,2542,2543)
 1.228 ms 36 /classes/ProductAssembler.php:95
80 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value
 1.186 ms 216 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
90 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE p.date_add>'2026-06-03 00:00:00'
 1.165 ms 216 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
729 
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `och438category_product` cp
LEFT JOIN `och438category` c ON (c.id_category = cp.id_category)
LEFT JOIN `och438category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (690,693,1717,718,2429,2427,2428,2433,756,2662,1168,2521,1658,1285,1374,1718,1719,1335,1709,1866,1867,1939,1973,1974,1994,2005,2007,2320,2321,2349,2497,2498,2499,2500,2542,2543) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
 1.139 ms 2745 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:103
22 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 1.133 ms 104 /classes/module/Module.php:341
74 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
 1.122 ms 61 Yes /classes/Category.php:710
81 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value
 1.119 ms 216 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
84 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM och438product p INNER JOIN och438layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 6) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40
 1.086 ms 108 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
76 
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC
 1.072 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
628 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2662) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 1.009 ms 1 Yes Yes /classes/Product.php:4513
78 
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC
 1.006 ms 14 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
68 
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `och438feature` f  INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `och438feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `och438layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
 0.974 ms 6 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:159
67 
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `och438attribute_group` ag  INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `och438layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
 0.965 ms 4 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122
63 
SELECT SQL_NO_CACHE * FROM och438revslider_sliders
 0.931 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
20 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `och438meta` m
LEFT JOIN `och438meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.926 ms 57 Yes /classes/Dispatcher.php:654
619 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2428) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.926 ms 1 Yes Yes /classes/Product.php:4513
625 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (756) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.924 ms 1 Yes Yes /classes/Product.php:4513
601 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (690) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.890 ms 1 Yes Yes /classes/Product.php:4513
18 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.883 ms 104 /classes/module/Module.php:341
66 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM och438layered_category
WHERE controller = 'category'
AND id_category = 22
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.866 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
631 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1168) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.855 ms 1 Yes Yes /classes/Product.php:4513
633 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2521 LIMIT 1
 0.852 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
568 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2543) AND (b.`id_shop` = 1) LIMIT 1
 0.846 ms 1 /src/Adapter/EntityMapper.php:71
622 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2433) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.837 ms 1 Yes Yes /classes/Product.php:4513
54 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.813 ms 0 /classes/module/Module.php:2664
31 
SELECT SQL_NO_CACHE id_shop
FROM `och438currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
 0.812 ms 1 /classes/ObjectModel.php:1727
62 
SELECT SQL_NO_CACHE *
FROM `och438category` a0
LEFT JOIN `och438category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 7) AND (a0.`nright` > 40) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.807 ms 4 /classes/PrestaShopCollection.php:383
610 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (718) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.792 ms 1 Yes Yes /classes/Product.php:4513
604 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.788 ms 1 Yes Yes /classes/Product.php:4513
57 
SELECT SQL_NO_CACHE format
FROM `och438address_format`
WHERE `id_country` = 6 LIMIT 1
 0.776 ms 1 /classes/AddressFormat.php:653
624 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 756 LIMIT 1
 0.774 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
607 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1717) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.722 ms 1 Yes Yes /classes/Product.php:4513
573 
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.716 ms 13 /classes/CartRule.php:357
86 
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute
 0.715 ms 216 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
23 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) AND (b.`id_shop` = 1) LIMIT 1
 0.706 ms 1 /src/Adapter/EntityMapper.php:71
613 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2429) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.704 ms 1 Yes Yes /classes/Product.php:4513
616 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2427) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.704 ms 1 Yes Yes /classes/Product.php:4513
88 
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 100, 6, 70, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute
 0.697 ms 216 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
712 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `och438category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `och438category` c2 ON c2.`id_category` = 22 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 6 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
 0.689 ms 61 Yes Yes /classes/Category.php:785
598 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitreviews" LIMIT 1
 0.679 ms 1 /classes/module/Module.php:2664
17 
SELECT SQL_NO_CACHE value FROM `och438configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.665 ms 1 /classes/shop/Shop.php:1183
56 
SELECT SQL_NO_CACHE * FROM `och438image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.661 ms 8 Yes /classes/ImageType.php:109
574 
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.656 ms 13 /classes/CartRule.php:357
627 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2662 LIMIT 1
 0.655 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
339 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1973 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1973 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.654 ms 0 /classes/Cart.php:1430
64 
SELECT SQL_NO_CACHE `name`
FROM `och438hook`
WHERE `id_hook` = 746 LIMIT 1
 0.653 ms 1 /classes/Hook.php:244
630 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1168 LIMIT 1
 0.653 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
152 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2429
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.651 ms 1 /classes/SpecificPrice.php:256
688 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2349) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.651 ms 1 Yes Yes /classes/Product.php:4513
621 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2433 LIMIT 1
 0.650 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
623 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 756
 0.650 ms 2 /classes/Product.php:3420
348 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1974 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1974 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.649 ms 0 /classes/Cart.php:1430
629 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1168
 0.649 ms 1 /classes/Product.php:3420
569 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2543
ORDER BY `position`
 0.646 ms 1 Yes /classes/Product.php:3539
572 
SELECT SQL_NO_CACHE 1 FROM och438cart_product cp INNER JOIN och438product p
ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
 0.643 ms 1 /classes/Cart.php:4250
634 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.634 ms 1 Yes Yes /classes/Product.php:4513
620 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2433
 0.633 ms 2 /classes/Product.php:3420
603 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 693 LIMIT 1
 0.629 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
626 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2662
 0.618 ms 2 /classes/Product.php:3420
59 
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
 0.616 ms 1 /src/Adapter/EntityMapper.php:71
35 
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
 0.613 ms 1 /classes/Category.php:2446
686 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2349
 0.612 ms 2 /classes/Product.php:3420
577 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `och438currency` c
LEFT JOIN och438currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.606 ms 1 /classes/Currency.php:1134
24 
SELECT SQL_NO_CACHE * FROM `och438currency` c ORDER BY `iso_code` ASC
 0.604 ms 1 Yes /classes/Currency.php:708
615 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2427 LIMIT 1
 0.603 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
71 
SELECT SQL_NO_CACHE *
FROM `och438category_lang`
WHERE `id_category` = 22 AND `id_shop` = 1
 0.596 ms 1 /src/Adapter/EntityMapper.php:79
70 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) LIMIT 1
 0.593 ms 1 /src/Adapter/EntityMapper.php:71
612 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2429 LIMIT 1
 0.591 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
53 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 275) AND (b.`id_shop` = 1) LIMIT 1
 0.588 ms 1 /src/Adapter/EntityMapper.php:71
618 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2428 LIMIT 1
 0.582 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
50 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 138) AND (b.`id_shop` = 1) LIMIT 1
 0.581 ms 1 /src/Adapter/EntityMapper.php:71
61 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM och438required_field
 0.580 ms 1 /classes/ObjectModel.php:1592
85 
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC
 0.579 ms 3 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
247 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1285 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.579 ms 1 Yes /classes/SpecificPrice.php:576
578 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.578 ms 1 /classes/module/Module.php:2664
43 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) AND (b.`id_shop` = 1) LIMIT 1
 0.577 ms 1 /src/Adapter/EntityMapper.php:71
38 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 26) AND (b.`id_shop` = 1) LIMIT 1
 0.574 ms 1 /src/Adapter/EntityMapper.php:71
609 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 718 LIMIT 1
 0.570 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
632 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2521
 0.570 ms 2 /classes/Product.php:3420
27 
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.567 ms 1 /src/Adapter/EntityMapper.php:71
51 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 272) AND (b.`id_shop` = 1) LIMIT 1
 0.562 ms 1 /src/Adapter/EntityMapper.php:71
48 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1
 0.561 ms 1 /src/Adapter/EntityMapper.php:71
399 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2349 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.561 ms 1 Yes /classes/SpecificPrice.php:576
153 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2429 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.560 ms 1 Yes /classes/SpecificPrice.php:576
296 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1709) AND (b.`id_shop` = 1) LIMIT 1
 0.558 ms 1 /src/Adapter/EntityMapper.php:71
19 
SELECT SQL_NO_CACHE name, alias FROM `och438hook_alias`
 0.557 ms 88 /classes/Hook.php:342
32 
SELECT SQL_NO_CACHE *
FROM `och438group` a
LEFT JOIN `och438group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.555 ms 1 /src/Adapter/EntityMapper.php:71
283 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1719 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1719 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.555 ms 0 /classes/Cart.php:1430
571 
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c WHERE c.id_category = 22 LIMIT 1
 0.554 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
49 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1
 0.549 ms 1 /src/Adapter/EntityMapper.php:71
21 
SELECT SQL_NO_CACHE * FROM `och438hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.548 ms 1 /classes/module/Module.php:2046
58 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `och438country`
WHERE `id_country` = 6 LIMIT 1
 0.548 ms 1 /classes/Country.php:402
233 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2521
ORDER BY f.position ASC
 0.547 ms 1 Yes /classes/Product.php:6024
41 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
 0.545 ms 1 /src/Adapter/EntityMapper.php:71
611 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2429
 0.543 ms 2 /classes/Product.php:3420
26 
SELECT SQL_NO_CACHE c.id_currency
FROM `och438currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.542 ms 1 /classes/Currency.php:893
29 
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.541 ms 1 /src/Adapter/EntityMapper.php:71
661 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1867) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.540 ms 1 Yes Yes /classes/Product.php:4513
600 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 690 LIMIT 1
 0.539 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
617 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2428
 0.538 ms 2 /classes/Product.php:3420
241 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1658 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1658 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.538 ms 0 /classes/Cart.php:1430
602 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 693
 0.535 ms 2 /classes/Product.php:3420
597 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 690
 0.533 ms 2 /classes/Product.php:3420
42 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 41) AND (b.`id_shop` = 1) LIMIT 1
 0.531 ms 1 /src/Adapter/EntityMapper.php:71
40 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
 0.530 ms 1 /src/Adapter/EntityMapper.php:71
676 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2005) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.530 ms 1 Yes Yes /classes/Product.php:4513
39 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 29) AND (b.`id_shop` = 1) LIMIT 1
 0.529 ms 1 /src/Adapter/EntityMapper.php:71
606 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1717 LIMIT 1
 0.528 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
220 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1168 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1168 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.526 ms 0 /classes/Cart.php:1430
614 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2427
 0.523 ms 2 /classes/Product.php:3420
73 
SELECT SQL_NO_CACHE data FROM och438layered_filter_block WHERE hash="980ca526b4809d5419323dd6b4053dd3" LIMIT 1
 0.519 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
482 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2428) AND (b.`id_shop` = 1) LIMIT 1
 0.519 ms 1 /src/Adapter/EntityMapper.php:71
608 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 718
 0.519 ms 2 /classes/Product.php:3420
45 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
 0.518 ms 1 /src/Adapter/EntityMapper.php:71
375 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2007 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2007 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.518 ms 0 /classes/Cart.php:1430
588 
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `och438cart_product`
WHERE `id_cart` = 0 LIMIT 1
 0.517 ms 1 /classes/Cart.php:1300
693 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2498 LIMIT 1
 0.517 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
28 
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.513 ms 1 /classes/Language.php:880
384 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2320 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2320 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.513 ms 0 /classes/Cart.php:1430
52 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 274) AND (b.`id_shop` = 1) LIMIT 1
 0.512 ms 1 /src/Adapter/EntityMapper.php:71
47 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 94) AND (b.`id_shop` = 1) LIMIT 1
 0.512 ms 1 /src/Adapter/EntityMapper.php:71
60 
SELECT SQL_NO_CACHE *
FROM `och438country_lang`
WHERE `id_country` = 6
 0.512 ms 1 /src/Adapter/EntityMapper.php:79
1 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM och438shop_url su
LEFT JOIN och438shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'farmacialanueva.online' OR su.domain_ssl = 'farmacialanueva.online')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.510 ms 1 Yes /classes/shop/Shop.php:1364
330 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1939 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1939 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.510 ms 0 /classes/Cart.php:1430
192 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2433 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2433 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.509 ms 0 /classes/Cart.php:1430
302 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1709 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1709 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.509 ms 0 /classes/Cart.php:1430
585 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 69 AND `id_shop` = 1 LIMIT 1
 0.509 ms 1 /classes/module/Module.php:2137
605 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1717
 0.508 ms 2 /classes/Product.php:3420
357 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1994 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1994 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.505 ms 0 /classes/Cart.php:1430
586 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsearch" LIMIT 1
 0.505 ms 1 /classes/module/Module.php:2664
44 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 43) AND (b.`id_shop` = 1) LIMIT 1
 0.504 ms 1 /src/Adapter/EntityMapper.php:71
2 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM och438shop_group gs
LEFT JOIN och438shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN och438shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.503 ms 1 Yes /classes/shop/Shop.php:715
25 
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.503 ms 1 /classes/Language.php:880
111 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 690 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 690 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.503 ms 0 /classes/Cart.php:1430
292 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1335 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1335 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.503 ms 0 /classes/Cart.php:1430
227 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.502 ms 1 Yes /classes/SpecificPrice.php:576
320 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1867 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1867 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.501 ms 0 /classes/Cart.php:1430
340 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1973
ORDER BY f.position ASC
 0.501 ms 1 Yes /classes/Product.php:6024
36 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM och438category_group ctg
WHERE ctg.`id_category` = 22 AND ctg.`id_group` = 1 LIMIT 1
 0.500 ms 1 /classes/Category.php:1751
643 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1374) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.500 ms 1 Yes Yes /classes/Product.php:4513
46 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) AND (b.`id_shop` = 1) LIMIT 1
 0.499 ms 1 /src/Adapter/EntityMapper.php:71
87 
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC
 0.499 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
637 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1658) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.498 ms 1 Yes Yes /classes/Product.php:4513
706 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.496 ms 1 Yes Yes /classes/Product.php:4513
593 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitproductsnav" LIMIT 1
 0.495 ms 1 /classes/module/Module.php:2664
523 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1867) AND (b.`id_shop` = 1) LIMIT 1
 0.491 ms 1 /src/Adapter/EntityMapper.php:71
404 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2349 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2349 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.489 ms 0 /classes/Cart.php:1430
640 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1285) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.489 ms 1 Yes Yes /classes/Product.php:4513
576 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
 0.488 ms 1 /classes/module/Module.php:2137
575 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitlinksmanager" LIMIT 1
 0.485 ms 1 /classes/module/Module.php:2664
594 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
 0.485 ms 1 /classes/module/Module.php:2137
158 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2429 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2429 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.483 ms 0 /classes/Cart.php:1430
685 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2321) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.483 ms 1 Yes Yes /classes/Product.php:4513
146 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 718 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 718 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.482 ms 0 /classes/Cart.php:1430
694 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2498) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.481 ms 1 Yes Yes /classes/Product.php:4513
682 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2320) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.480 ms 1 Yes Yes /classes/Product.php:4513
33 
SELECT SQL_NO_CACHE *
FROM `och438group_lang`
WHERE `id_group` = 1
 0.479 ms 1 /src/Adapter/EntityMapper.php:79
494 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1168) AND (b.`id_shop` = 1) LIMIT 1
 0.478 ms 1 /src/Adapter/EntityMapper.php:71
479 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2427) AND (b.`id_shop` = 1) LIMIT 1
 0.477 ms 1 /src/Adapter/EntityMapper.php:71
132 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1717 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.476 ms 1 Yes /classes/SpecificPrice.php:576
55 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.476 ms 0 /classes/module/Module.php:2137
570 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2543
 0.474 ms 1 /classes/Product.php:2899
667 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1973) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.474 ms 1 Yes Yes /classes/Product.php:4513
12 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `och438lang` l
JOIN och438lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.473 ms 1 /classes/Language.php:1214
65 
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
 0.473 ms 1 /classes/Category.php:2446
272 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1718 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1718 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.472 ms 0 /classes/Cart.php:1430
488 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 756) AND (b.`id_shop` = 1) LIMIT 1
 0.472 ms 1 /src/Adapter/EntityMapper.php:71
485 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2433) AND (b.`id_shop` = 1) LIMIT 1
 0.471 ms 1 /src/Adapter/EntityMapper.php:71
599 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 83 AND `id_shop` = 1 LIMIT 1
 0.470 ms 1 /classes/module/Module.php:2137
646 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1718) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.470 ms 1 Yes Yes /classes/Product.php:4513
649 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1719) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.469 ms 1 Yes Yes /classes/Product.php:4513
182 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2433
AND image_shop.`cover` = 1 LIMIT 1
 0.469 ms 1 /classes/Product.php:3570
491 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2662) AND (b.`id_shop` = 1) LIMIT 1
 0.468 ms 1 /src/Adapter/EntityMapper.php:71
652 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1335) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.468 ms 1 Yes Yes /classes/Product.php:4513
232 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.467 ms 0 /classes/Cart.php:1430
446 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.467 ms 1 Yes /classes/SpecificPrice.php:576
553 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2497) AND (b.`id_shop` = 1) LIMIT 1
 0.465 ms 1 /src/Adapter/EntityMapper.php:71
673 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1994) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.463 ms 1 Yes Yes /classes/Product.php:4513
550 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2349) AND (b.`id_shop` = 1) LIMIT 1
 0.462 ms 1 /src/Adapter/EntityMapper.php:71
366 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2005 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2005 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.461 ms 0 /classes/Cart.php:1430
592 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
 0.461 ms 1 /classes/module/Module.php:2137
211 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2662 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2662 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.460 ms 0 /classes/Cart.php:1430
460 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.460 ms 0 /classes/Cart.php:1430
30 
SELECT SQL_NO_CACHE *
FROM `och438currency_lang`
WHERE `id_currency` = 1
 0.458 ms 1 /src/Adapter/EntityMapper.php:79
670 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1974) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.458 ms 1 Yes Yes /classes/Product.php:4513
278 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1719 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.454 ms 1 Yes /classes/SpecificPrice.php:576
579 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
 0.454 ms 1 /classes/module/Module.php:2137
462 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 690) AND (b.`id_shop` = 1) LIMIT 1
 0.452 ms 1 /src/Adapter/EntityMapper.php:71
187 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2433 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.451 ms 1 Yes /classes/SpecificPrice.php:576
34 
SELECT SQL_NO_CACHE id_shop
FROM `och438group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.450 ms 1 /classes/ObjectModel.php:1727
664 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1939) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.449 ms 1 Yes Yes /classes/Product.php:4513
393 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2321 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2321 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.448 ms 0 /classes/Cart.php:1430
422 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2498 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2498 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.448 ms 0 /classes/Cart.php:1430
529 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1973) AND (b.`id_shop` = 1) LIMIT 1
 0.448 ms 1 /src/Adapter/EntityMapper.php:71
164 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2427 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.446 ms 1 Yes /classes/SpecificPrice.php:576
175 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2428 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.446 ms 1 Yes /classes/SpecificPrice.php:576
349 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1974
ORDER BY f.position ASC
 0.446 ms 1 Yes /classes/Product.php:6024
544 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2320) AND (b.`id_shop` = 1) LIMIT 1
 0.446 ms 1 /src/Adapter/EntityMapper.php:71
405 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2349
ORDER BY f.position ASC
 0.446 ms 1 Yes /classes/Product.php:6024
582 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitwishlist" LIMIT 1
 0.446 ms 1 /classes/module/Module.php:2664
467 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 693) AND (b.`id_shop` = 1) LIMIT 1
 0.444 ms 1 /src/Adapter/EntityMapper.php:71
267 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1718 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.443 ms 1 Yes /classes/SpecificPrice.php:576
595 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_facetedsearch" LIMIT 1
 0.442 ms 1 /classes/module/Module.php:2664
538 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2005) AND (b.`id_shop` = 1) LIMIT 1
 0.442 ms 1 /src/Adapter/EntityMapper.php:71
590 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 32 AND `id_shop` = 1 LIMIT 1
 0.441 ms 1 /classes/module/Module.php:2137
261 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1374 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1374 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.440 ms 0 /classes/Cart.php:1430
591 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitmegamenu" LIMIT 1
 0.440 ms 1 /classes/module/Module.php:2664
120 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.439 ms 0 /classes/Cart.php:1430
589 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_shoppingcart" LIMIT 1
 0.438 ms 1 /classes/module/Module.php:2664
532 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1974) AND (b.`id_shop` = 1) LIMIT 1
 0.437 ms 1 /src/Adapter/EntityMapper.php:71
691 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2497) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.437 ms 1 Yes Yes /classes/Product.php:4513
137 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1717 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1717 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.436 ms 0 /classes/Cart.php:1430
358 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1994
ORDER BY f.position ASC
 0.436 ms 1 Yes /classes/Product.php:6024
526 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1939) AND (b.`id_shop` = 1) LIMIT 1
 0.436 ms 1 /src/Adapter/EntityMapper.php:71
580 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.436 ms 1 /classes/module/Module.php:2664
440 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2500 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2500 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.434 ms 0 /classes/Cart.php:1430
645 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1718 LIMIT 1
 0.434 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
9 
SELECT SQL_NO_CACHE *
FROM `och438lang` a
LEFT JOIN `och438lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
 0.432 ms 1 /src/Adapter/EntityMapper.php:71
128 
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `och438specific_price` WHERE `id_product` != 0
 0.431 ms 521 /classes/SpecificPrice.php:310
506 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1374) AND (b.`id_shop` = 1) LIMIT 1
 0.431 ms 1 /src/Adapter/EntityMapper.php:71
584 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcompare" LIMIT 1
 0.431 ms 1 /classes/module/Module.php:2664
451 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.430 ms 0 /classes/Cart.php:1430
252 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1285 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.429 ms 0 /classes/Cart.php:1430
541 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2007) AND (b.`id_shop` = 1) LIMIT 1
 0.429 ms 1 /src/Adapter/EntityMapper.php:71
679 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2007) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.429 ms 1 Yes Yes /classes/Product.php:4513
477 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2429
ORDER BY `position`
 0.428 ms 1 Yes /classes/Product.php:3539
651 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1335 LIMIT 1
 0.428 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
556 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2498) AND (b.`id_shop` = 1) LIMIT 1
 0.427 ms 1 /src/Adapter/EntityMapper.php:71
562 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2500) AND (b.`id_shop` = 1) LIMIT 1
 0.426 ms 1 /src/Adapter/EntityMapper.php:71
535 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1994) AND (b.`id_shop` = 1) LIMIT 1
 0.425 ms 1 /src/Adapter/EntityMapper.php:71
678 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2007 LIMIT 1
 0.423 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
169 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2427 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2427 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.423 ms 0 /classes/Cart.php:1430
284 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1719
ORDER BY f.position ASC
 0.423 ms 1 Yes /classes/Product.php:6024
548 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2321
ORDER BY `position`
 0.423 ms 1 Yes /classes/Product.php:3539
0 
SELECT SQL_NO_CACHE * FROM och438memcached_servers
 0.422 ms 1 /classes/cache/CacheMemcached.php:263
311 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1866 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1866 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.422 ms 0 /classes/Cart.php:1430
385 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2320
ORDER BY f.position ASC
 0.422 ms 1 Yes /classes/Product.php:6024
180 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2428 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2428 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.421 ms 0 /classes/Cart.php:1430
515 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1335) AND (b.`id_shop` = 1) LIMIT 1
 0.421 ms 1 /src/Adapter/EntityMapper.php:71
431 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2499 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2499 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.421 ms 0 /classes/Cart.php:1430
116 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 693)
 0.419 ms 1 /classes/Product.php:3860
509 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1718) AND (b.`id_shop` = 1) LIMIT 1
 0.419 ms 1 /src/Adapter/EntityMapper.php:71
331 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1939
ORDER BY f.position ASC
 0.418 ms 1 Yes /classes/Product.php:6024
587 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
 0.417 ms 1 /classes/module/Module.php:2137
521 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1866
ORDER BY `position`
 0.417 ms 1 Yes /classes/Product.php:3539
104 
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.416 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:100
242 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1658
ORDER BY f.position ASC
 0.416 ms 1 Yes /classes/Product.php:6024
581 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
 0.416 ms 1 /classes/module/Module.php:2137
697 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2499) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.416 ms 1 Yes Yes /classes/Product.php:4513
332 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1973
AND image_shop.`cover` = 1 LIMIT 1
 0.415 ms 1 /classes/Product.php:3570
547 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2321) AND (b.`id_shop` = 1) LIMIT 1
 0.415 ms 1 /src/Adapter/EntityMapper.php:71
201 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 756 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 756 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.415 ms 0 /classes/Cart.php:1430
520 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1866) AND (b.`id_shop` = 1) LIMIT 1
 0.415 ms 1 /src/Adapter/EntityMapper.php:71
273 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1718
ORDER BY f.position ASC
 0.414 ms 1 Yes /classes/Product.php:6024
441 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2500
ORDER BY f.position ASC
 0.413 ms 1 Yes /classes/Product.php:6024
497 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2521) AND (b.`id_shop` = 1) LIMIT 1
 0.413 ms 1 /src/Adapter/EntityMapper.php:71
234 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1658
AND image_shop.`cover` = 1 LIMIT 1
 0.411 ms 1 /classes/Product.php:3570
288 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1335)
 0.410 ms 1 /classes/Product.php:3860
6 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `och438lang` l
LEFT JOIN `och438lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.410 ms 1 /classes/Language.php:1080
655 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1709) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.409 ms 1 Yes Yes /classes/Product.php:4513
500 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1658) AND (b.`id_shop` = 1) LIMIT 1
 0.409 ms 1 /src/Adapter/EntityMapper.php:71
596 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 64 AND `id_shop` = 1 LIMIT 1
 0.408 ms 1 /classes/module/Module.php:2137
274 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1719
AND image_shop.`cover` = 1 LIMIT 1
 0.406 ms 1 /classes/Product.php:3570
303 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1709
ORDER BY f.position ASC
 0.406 ms 1 Yes /classes/Product.php:6024
473 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 718) AND (b.`id_shop` = 1) LIMIT 1
 0.406 ms 1 /src/Adapter/EntityMapper.php:71
726 
SELECT SQL_NO_CACHE `id_guest`
FROM `och438connections`
WHERE `id_guest` = 199262
AND `date_add` > '2026-06-22 19:27:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
 0.406 ms 1 Yes /classes/Connection.php:168
376 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2007
ORDER BY f.position ASC
 0.405 ms 1 Yes /classes/Product.php:6024
470 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1717) AND (b.`id_shop` = 1) LIMIT 1
 0.405 ms 1 /src/Adapter/EntityMapper.php:71
583 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
 0.405 ms 1 /classes/module/Module.php:2137
658 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1866) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.405 ms 1 Yes Yes /classes/Product.php:4513
483 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2428
ORDER BY `position`
 0.404 ms 1 Yes /classes/Product.php:3539
700 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2500) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.404 ms 1 Yes Yes /classes/Product.php:4513
11 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM och438shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.404 ms 1 /classes/shop/ShopUrl.php:178
341 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1974
AND image_shop.`cover` = 1 LIMIT 1
 0.404 ms 1 /classes/Product.php:3570
684 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2321 LIMIT 1
 0.404 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
133 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1717)
 0.403 ms 1 /classes/Product.php:3860
293 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1335
ORDER BY f.position ASC
 0.403 ms 1 Yes /classes/Product.php:6024
559 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2499) AND (b.`id_shop` = 1) LIMIT 1
 0.402 ms 1 /src/Adapter/EntityMapper.php:71
413 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2497 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2497 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.401 ms 0 /classes/Cart.php:1430
687 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2349 LIMIT 1
 0.401 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
112 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 690
ORDER BY f.position ASC
 0.400 ms 1 Yes /classes/Product.php:6024
565 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2542) AND (b.`id_shop` = 1) LIMIT 1
 0.400 ms 1 /src/Adapter/EntityMapper.php:71
486 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2433
ORDER BY `position`
 0.399 ms 1 Yes /classes/Product.php:3539
663 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1939 LIMIT 1
 0.399 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
557 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2498
ORDER BY `position`
 0.395 ms 1 Yes /classes/Product.php:3539
480 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2427
ORDER BY `position`
 0.394 ms 1 Yes /classes/Product.php:3539
554 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2497
ORDER BY `position`
 0.394 ms 1 Yes /classes/Product.php:3539
237 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1658)
 0.393 ms 1 /classes/Product.php:3860
512 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1719) AND (b.`id_shop` = 1) LIMIT 1
 0.392 ms 1 /src/Adapter/EntityMapper.php:71
394 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2321
ORDER BY f.position ASC
 0.391 ms 1 Yes /classes/Product.php:6024
170 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2427
ORDER BY f.position ASC
 0.390 ms 1 Yes /classes/Product.php:6024
298 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1709)
 0.390 ms 1 /classes/Product.php:3860
418 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2498)
 0.389 ms 1 /classes/Product.php:3860
468 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 693
ORDER BY `position`
 0.389 ms 1 Yes /classes/Product.php:3539
243 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1285
AND image_shop.`cover` = 1 LIMIT 1
 0.387 ms 1 /classes/Product.php:3570
362 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2005)
 0.386 ms 1 /classes/Product.php:3860
307 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1866)
 0.384 ms 1 /classes/Product.php:3860
636 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1658 LIMIT 1
 0.384 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
321 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1867
ORDER BY f.position ASC
 0.384 ms 1 Yes /classes/Product.php:6024
388 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2321 LIMIT 1
 0.384 ms 1 /classes/SpecificPrice.php:435
489 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 756
ORDER BY `position`
 0.384 ms 2 Yes /classes/Product.php:3539
353 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1994)
 0.383 ms 1 /classes/Product.php:3860
389 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2321)
 0.382 ms 1 /classes/Product.php:3860
8 
SELECT SQL_NO_CACHE *
FROM `och438shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.382 ms 1 /src/Adapter/EntityMapper.php:71
263 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1718
AND image_shop.`cover` = 1 LIMIT 1
 0.382 ms 1 /classes/Product.php:3570
669 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1974 LIMIT 1
 0.382 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
377 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2320
AND image_shop.`cover` = 1 LIMIT 1
 0.381 ms 1 /classes/Product.php:3570
461 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2543
ORDER BY f.position ASC
 0.381 ms 1 Yes /classes/Product.php:6024
681 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2320 LIMIT 1
 0.381 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
476 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2429) AND (b.`id_shop` = 1) LIMIT 1
 0.380 ms 1 /src/Adapter/EntityMapper.php:71
563 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2500
ORDER BY `position`
 0.379 ms 1 Yes /classes/Product.php:3539
262 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1374
ORDER BY f.position ASC
 0.379 ms 1 Yes /classes/Product.php:6024
639 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1285 LIMIT 1
 0.378 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
7 
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
 0.377 ms 1 /src/Adapter/EntityMapper.php:71
109 
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.377 ms 0 /classes/tax/TaxRulesTaxManager.php:100
363 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2005 AND id_shop=1 LIMIT 1
 0.377 ms 1 /classes/Product.php:6884
100 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 690)
 0.376 ms 1 /classes/Product.php:3860
312 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1866
ORDER BY f.position ASC
 0.376 ms 1 Yes /classes/Product.php:6024
695 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2499
 0.376 ms 2 /classes/Product.php:3420
138 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1717
ORDER BY f.position ASC
 0.375 ms 1 Yes /classes/Product.php:6024
181 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2428
ORDER BY f.position ASC
 0.375 ms 1 Yes /classes/Product.php:6024
503 
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1285) AND (b.`id_shop` = 1) LIMIT 1
 0.374 ms 1 /src/Adapter/EntityMapper.php:71
322 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1939
AND image_shop.`cover` = 1 LIMIT 1
 0.374 ms 1 /classes/Product.php:3570
642 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1374 LIMIT 1
 0.374 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
10 
SELECT SQL_NO_CACHE id_shop
FROM `och438lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
 0.373 ms 1 /classes/ObjectModel.php:1727
696 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2499 LIMIT 1
 0.373 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
414 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2497
ORDER BY f.position ASC
 0.373 ms 1 Yes /classes/Product.php:6024
492 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2662
ORDER BY `position`
 0.373 ms 1 Yes /classes/Product.php:3539
313 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1867
AND image_shop.`cover` = 1 LIMIT 1
 0.372 ms 1 /classes/Product.php:3570
154 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2429)
 0.372 ms 1 /classes/Product.php:3860
350 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1994
AND image_shop.`cover` = 1 LIMIT 1
 0.372 ms 1 /classes/Product.php:3570
675 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2005 LIMIT 1
 0.372 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
285 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1335
AND image_shop.`cover` = 1 LIMIT 1
 0.371 ms 1 /classes/Product.php:3570
294 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1709
AND image_shop.`cover` = 1 LIMIT 1
 0.371 ms 1 /classes/Product.php:3570
126 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1717 LIMIT 1
 0.370 ms 1 /classes/SpecificPrice.php:435
371 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2007)
 0.370 ms 1 /classes/Product.php:3860
121 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 693
ORDER BY f.position ASC
 0.369 ms 1 Yes /classes/Product.php:6024
145 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 718) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.369 ms 1 /classes/stock/StockAvailable.php:453
304 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1866
AND image_shop.`cover` = 1 LIMIT 1
 0.369 ms 1 /classes/Product.php:3570
406 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2497
AND image_shop.`cover` = 1 LIMIT 1
 0.369 ms 1 /classes/Product.php:3570
644 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1718
 0.369 ms 3 /classes/Product.php:3420
107 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 690 AND `id_group` = 1 LIMIT 1
 0.369 ms 0 /classes/GroupReduction.php:153
666 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1973 LIMIT 1
 0.368 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
539 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2005
ORDER BY `position`
 0.367 ms 1 Yes /classes/Product.php:3539
648 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1719 LIMIT 1
 0.367 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
665 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1973
 0.367 ms 2 /classes/Product.php:3420
347 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1974) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.367 ms 1 /classes/stock/StockAvailable.php:453
105 
SELECT SQL_NO_CACHE *
FROM `och438tax` a
WHERE (a.`id_tax` = 31) LIMIT 1
 0.366 ms 1 /src/Adapter/EntityMapper.php:71
129 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `from` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
 0.366 ms 1 /classes/SpecificPrice.php:377
203 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2662
AND image_shop.`cover` = 1 LIMIT 1
 0.366 ms 1 /classes/Product.php:3570
212 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2662
ORDER BY f.position ASC
 0.366 ms 1 Yes /classes/Product.php:6024
423 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2498
ORDER BY f.position ASC
 0.366 ms 1 Yes /classes/Product.php:6024
316 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1867)
 0.365 ms 1 /classes/Product.php:3860
123 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 130 LIMIT 1
 0.364 ms 1 /classes/Category.php:1373
147 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 718
ORDER BY f.position ASC
 0.364 ms 1 Yes /classes/Product.php:6024
518 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1709
ORDER BY `position`
 0.364 ms 1 Yes /classes/Product.php:3539
635 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1658
 0.364 ms 2 /classes/Product.php:3420
660 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1867 LIMIT 1
 0.364 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
171 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2428
AND image_shop.`cover` = 1 LIMIT 1
 0.363 ms 1 /classes/Product.php:3570
310 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1866) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.363 ms 1 /classes/stock/StockAvailable.php:453
257 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1374)
 0.363 ms 1 /classes/Product.php:3860
501 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1658
ORDER BY `position`
 0.363 ms 1 Yes /classes/Product.php:3539
395 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2349
AND image_shop.`cover` = 1 LIMIT 1
 0.362 ms 1 /classes/Product.php:3570
641 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1374
 0.362 ms 2 /classes/Product.php:3420
367 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2005
ORDER BY f.position ASC
 0.359 ms 1 Yes /classes/Product.php:6024
690 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2497 LIMIT 1
 0.359 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
359 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2005
AND image_shop.`cover` = 1 LIMIT 1
 0.358 ms 1 /classes/Product.php:3570
442 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2542
AND image_shop.`cover` = 1 LIMIT 1
 0.358 ms 2 /classes/Product.php:3570
495 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1168
ORDER BY `position`
 0.358 ms 1 Yes /classes/Product.php:3539
344 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1974)
 0.358 ms 1 /classes/Product.php:3860
365 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2005) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.357 ms 1 /classes/stock/StockAvailable.php:453
221 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1168
ORDER BY f.position ASC
 0.357 ms 1 Yes /classes/Product.php:6024
94 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 690
AND image_shop.`cover` = 1 LIMIT 1
 0.356 ms 1 /classes/Product.php:3570
193 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2433
ORDER BY f.position ASC
 0.356 ms 1 Yes /classes/Product.php:6024
536 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1994
ORDER BY `position`
 0.356 ms 1 Yes /classes/Product.php:3539
542 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2007
ORDER BY `position`
 0.356 ms 1 Yes /classes/Product.php:3539
677 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2007
 0.356 ms 2 /classes/Product.php:3420
119 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.355 ms 1 /classes/stock/StockAvailable.php:453
253 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1285
ORDER BY f.position ASC
 0.355 ms 1 Yes /classes/Product.php:6024
268 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1718)
 0.355 ms 1 /classes/Product.php:3860
452 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2542
ORDER BY f.position ASC
 0.355 ms 1 Yes /classes/Product.php:6024
516 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1335
ORDER BY `position`
 0.355 ms 1 Yes /classes/Product.php:3539
638 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1285
 0.355 ms 3 /classes/Product.php:3420
159 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2429
ORDER BY f.position ASC
 0.354 ms 1 Yes /classes/Product.php:6024
248 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1285)
 0.354 ms 1 /classes/Product.php:3860
286 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.354 ms 1 /classes/Product.php:5670
336 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1973 AND id_shop=1 LIMIT 1
 0.354 ms 1 /classes/Product.php:6884
378 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.354 ms 1 /classes/Product.php:5670
400 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2349)
 0.354 ms 1 /classes/Product.php:3860
416 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.354 ms 1 /classes/Product.php:5670
671 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1994
 0.353 ms 2 /classes/Product.php:3420
335 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1973)
 0.353 ms 1 /classes/Product.php:3860
662 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1939
 0.352 ms 3 /classes/Product.php:3420
463 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 690
ORDER BY `position`
 0.351 ms 1 Yes /classes/Product.php:3539
530 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1973
ORDER BY `position`
 0.350 ms 1 Yes /classes/Product.php:3539
545 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2320
ORDER BY `position`
 0.350 ms 1 Yes /classes/Product.php:3539
368 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2007
AND image_shop.`cover` = 1 LIMIT 1
 0.349 ms 1 /classes/Product.php:3570
657 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1866 LIMIT 1
 0.349 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
551 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2349
ORDER BY `position`
 0.348 ms 1 Yes /classes/Product.php:3539
702 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2542 LIMIT 1
 0.348 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
484 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2428
 0.348 ms 1 /classes/Product.php:2899
680 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2320
 0.347 ms 3 /classes/Product.php:3420
560 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2499
ORDER BY `position`
 0.346 ms 1 Yes /classes/Product.php:3539
705 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2543 LIMIT 1
 0.346 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
668 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1974
 0.346 ms 2 /classes/Product.php:3420
360 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.345 ms 1 /classes/Product.php:5670
683 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2321
 0.344 ms 2 /classes/Product.php:3420
527 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1939
ORDER BY `position`
 0.344 ms 1 Yes /classes/Product.php:3539
142 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 718)
 0.343 ms 1 /classes/Product.php:3860
432 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2499
ORDER BY f.position ASC
 0.342 ms 1 Yes /classes/Product.php:6024
647 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1719
 0.342 ms 4 /classes/Product.php:3420
213 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1168
AND image_shop.`cover` = 1 LIMIT 1
 0.342 ms 1 /classes/Product.php:3570
474 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 718
ORDER BY `position`
 0.341 ms 1 Yes /classes/Product.php:3539
202 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 756
ORDER BY f.position ASC
 0.341 ms 1 Yes /classes/Product.php:6024
342 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.340 ms 1 /classes/Product.php:5670
524 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1867
ORDER BY `position`
 0.340 ms 1 Yes /classes/Product.php:3539
533 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1974
ORDER BY `position`
 0.339 ms 1 Yes /classes/Product.php:3539
659 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1867
 0.339 ms 2 /classes/Product.php:3420
711 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
 0.339 ms 1 /classes/module/Module.php:2137
345 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1974 AND id_shop=1 LIMIT 1
 0.339 ms 1 /classes/Product.php:6884
240 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1658) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.338 ms 1 /classes/stock/StockAvailable.php:453
656 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1866
 0.338 ms 2 /classes/Product.php:3420
674 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2005
 0.338 ms 2 /classes/Product.php:3420
4 
SELECT SQL_NO_CACHE *
FROM `och438shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.337 ms 1 /src/Adapter/EntityMapper.php:71
15 
SELECT SQL_NO_CACHE `name`, `alias` FROM `och438hook_alias`
 0.337 ms 88 /classes/Hook.php:290
194 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 756
AND image_shop.`cover` = 1 LIMIT 1
 0.337 ms 2 /classes/Product.php:3570
228 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2521)
 0.337 ms 1 /classes/Product.php:3860
245 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1285 LIMIT 1
 0.337 ms 1 /classes/SpecificPrice.php:435
207 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2662)
 0.337 ms 1 /classes/Product.php:3860
115 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 693 LIMIT 1
 0.336 ms 1 /classes/SpecificPrice.php:435
701 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2542
 0.336 ms 2 /classes/Product.php:3420
95 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 22 LIMIT 1
 0.335 ms 1 /classes/Category.php:1373
338 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1973) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.335 ms 1 /classes/stock/StockAvailable.php:453
379 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2320 LIMIT 1
 0.335 ms 1 /classes/SpecificPrice.php:435
672 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1994 LIMIT 1
 0.335 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
185 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2433 LIMIT 1
 0.334 ms 1 /classes/SpecificPrice.php:435
287 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1335 LIMIT 1
 0.334 ms 1 /classes/SpecificPrice.php:435
415 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2498
AND image_shop.`cover` = 1 LIMIT 1
 0.334 ms 1 /classes/Product.php:3570
717 
SELECT SQL_NO_CACHE c.*, cl.*  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 121 ORDER BY `nleft` DESC
 0.334 ms 4 /classes/Category.php:1594
424 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2499
AND image_shop.`cover` = 1 LIMIT 1
 0.334 ms 1 /classes/Product.php:3570
408 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2497 LIMIT 1
 0.333 ms 1 /classes/SpecificPrice.php:435
465 
SELECT SQL_NO_CACHE state FROM och438feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.333 ms 1 /classes/FeatureFlag.php:105
728 
SELECT SQL_NO_CACHE data
FROM `och438ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
 0.332 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:39
513 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1719
ORDER BY `position`
 0.332 ms 1 Yes /classes/Product.php:3539
650 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1335
 0.332 ms 3 /classes/Product.php:3420
692 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2498
 0.332 ms 2 /classes/Product.php:3420
122 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1717
AND image_shop.`cover` = 1 LIMIT 1
 0.330 ms 1 /classes/Product.php:3570
291 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1335) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:453
383 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2320) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:453
98 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 0 LIMIT 1
 0.329 ms 1 /classes/SpecificPrice.php:426
301 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1709) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.329 ms 1 /classes/stock/StockAvailable.php:453
326 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1939)
 0.329 ms 1 /classes/Product.php:3860
654 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1709 LIMIT 1
 0.329 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
337 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1973 AND `id_group` = 1 LIMIT 1
 0.328 ms 0 /classes/GroupReduction.php:153
471 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1717
ORDER BY `position`
 0.328 ms 1 Yes /classes/Product.php:3539
498 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2521
ORDER BY `position`
 0.328 ms 1 Yes /classes/Product.php:3539
699 
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2500 LIMIT 1
 0.328 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
149 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 41 LIMIT 1
 0.328 ms 1 /classes/Category.php:1373
183 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 33 LIMIT 1
 0.328 ms 1 /classes/Category.php:1373
409 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2497)
 0.328 ms 1 /classes/Product.php:3860
361 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2005 LIMIT 1
 0.327 ms 1 /classes/SpecificPrice.php:435
374 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2007) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.327 ms 1 /classes/stock/StockAvailable.php:453
386 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2321
AND image_shop.`cover` = 1 LIMIT 1
 0.327 ms 1 /classes/Product.php:3570
407 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.327 ms 1 /classes/Product.php:5670
507 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1374
ORDER BY `position`
 0.326 ms 1 Yes /classes/Product.php:3539
566 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2542
ORDER BY `position`
 0.326 ms 2 Yes /classes/Product.php:3539
141 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 718 LIMIT 1
 0.325 ms 1 /classes/SpecificPrice.php:435
319 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1867) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.325 ms 1 /classes/stock/StockAvailable.php:453
490 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 756
 0.325 ms 1 /classes/Product.php:2899
510 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1718
ORDER BY `position`
 0.325 ms 1 Yes /classes/Product.php:3539
113 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 693
AND image_shop.`cover` = 1 LIMIT 1
 0.324 ms 1 /classes/Product.php:3570
188 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2433)
 0.324 ms 1 /classes/Product.php:3860
279 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1719)
 0.324 ms 1 /classes/Product.php:3860
346 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1974 AND `id_group` = 1 LIMIT 1
 0.324 ms 0 /classes/GroupReduction.php:153
421 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2498) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.324 ms 1 /classes/stock/StockAvailable.php:453
5 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM och438shop s
LEFT JOIN och438shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.323 ms 1 /classes/shop/Shop.php:214
160 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2427
AND image_shop.`cover` = 1 LIMIT 1
 0.323 ms 1 /classes/Product.php:3570
356 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1994) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.323 ms 1 /classes/stock/StockAvailable.php:453
456 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2543)
 0.323 ms 1 /classes/Product.php:3860
343 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1974 LIMIT 1
 0.322 ms 1 /classes/SpecificPrice.php:435
720 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsociallogin" LIMIT 1
 0.322 ms 1 /classes/module/Module.php:2664
504 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1285
ORDER BY `position`
 0.322 ms 1 Yes /classes/Product.php:3539
372 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2007 AND id_shop=1 LIMIT 1
 0.321 ms 1 /classes/Product.php:6884
447 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2542)
 0.321 ms 1 /classes/Product.php:3860
222 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2521
AND image_shop.`cover` = 1 LIMIT 1
 0.321 ms 1 /classes/Product.php:3570
427 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2499)
 0.320 ms 1 /classes/Product.php:3860
453 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2543
AND image_shop.`cover` = 1 LIMIT 1
 0.320 ms 1 /classes/Product.php:3570
165 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2427)
 0.320 ms 1 /classes/Product.php:3860
231 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.320 ms 1 /classes/stock/StockAvailable.php:453
235 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.320 ms 1 /classes/Product.php:5670
236 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1658 LIMIT 1
 0.320 ms 1 /classes/SpecificPrice.php:435
436 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2500)
 0.320 ms 1 /classes/Product.php:3860
653 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1709
 0.320 ms 2 /classes/Product.php:3420
110 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 690) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.319 ms 1 /classes/stock/StockAvailable.php:453
238 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1658 AND id_shop=1 LIMIT 1
 0.319 ms 1 /classes/Product.php:6884
380 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2320)
 0.319 ms 1 /classes/Product.php:3860
481 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2427
 0.319 ms 1 /classes/Product.php:2899
370 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2007 LIMIT 1
 0.318 ms 1 /classes/SpecificPrice.php:435
514 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1719
 0.317 ms 1 /classes/Product.php:2899
96 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.317 ms 1 /classes/Product.php:5670
282 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.316 ms 1 /classes/stock/StockAvailable.php:453
426 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2499 LIMIT 1
 0.316 ms 1 /classes/SpecificPrice.php:435
689 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2497
 0.316 ms 2 /classes/Product.php:3420
713 
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
 0.316 ms 1 /classes/Category.php:2239
403 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.315 ms 1 /classes/stock/StockAvailable.php:453
289 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1335 AND id_shop=1 LIMIT 1
 0.315 ms 1 /classes/Product.php:6884
314 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.315 ms 1 /classes/Product.php:5670
396 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.315 ms 1 /classes/Product.php:5670
433 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2500
AND image_shop.`cover` = 1 LIMIT 1
 0.315 ms 1 /classes/Product.php:3570
297 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1709 LIMIT 1
 0.314 ms 1 /classes/SpecificPrice.php:435
308 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1866 AND id_shop=1 LIMIT 1
 0.314 ms 1 /classes/Product.php:6884
478 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2429
 0.314 ms 1 /classes/Product.php:2899
99 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 690 LIMIT 1
 0.313 ms 1 /classes/SpecificPrice.php:435
148 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2429
AND image_shop.`cover` = 1 LIMIT 1
 0.313 ms 1 /classes/Product.php:3570
707 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitelementor" LIMIT 1
 0.313 ms 1 /classes/module/Module.php:2664
419 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2498 AND id_shop=1 LIMIT 1
 0.313 ms 1 /classes/Product.php:6884
216 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1168)
 0.312 ms 1 /classes/Product.php:3860
299 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1709 AND id_shop=1 LIMIT 1
 0.312 ms 1 /classes/Product.php:6884
392 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2321) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.312 ms 1 /classes/stock/StockAvailable.php:453
487 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2433
 0.312 ms 1 /classes/Product.php:2899
714 
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
 0.312 ms 1 /src/Adapter/EntityMapper.php:71
722 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitpopup" LIMIT 1
 0.312 ms 1 /classes/module/Module.php:2664
130 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `to` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
 0.311 ms 1 /classes/SpecificPrice.php:381
197 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 756)
 0.311 ms 1 /classes/Product.php:3860
210 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2662) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.311 ms 1 /classes/stock/StockAvailable.php:453
244 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.311 ms 1 /classes/Product.php:5670
317 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1867 AND id_shop=1 LIMIT 1
 0.311 ms 1 /classes/Product.php:6884
439 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2500) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.311 ms 1 /classes/stock/StockAvailable.php:453
306 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1866 LIMIT 1
 0.310 ms 1 /classes/SpecificPrice.php:435
305 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.310 ms 1 /classes/Product.php:5670
108 
SELECT SQL_NO_CACHE `reduction`
FROM `och438group`
WHERE `id_group` = 1 LIMIT 1
 0.309 ms 1 /classes/Group.php:151
223 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 29 LIMIT 1
 0.309 ms 1 /classes/Category.php:1373
254 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1374
AND image_shop.`cover` = 1 LIMIT 1
 0.309 ms 1 /classes/Product.php:3570
381 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2320 AND id_shop=1 LIMIT 1
 0.309 ms 1 /classes/Product.php:6884
373 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2007 AND `id_group` = 1 LIMIT 1
 0.308 ms 0 /classes/GroupReduction.php:153
387 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.308 ms 1 /classes/Product.php:5670
704 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2543
 0.308 ms 3 /classes/Product.php:3420
715 
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 22 LIMIT 1
 0.308 ms 1 /classes/Category.php:1584
176 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2428)
 0.307 ms 1 /classes/Product.php:3860
191 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2433) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.307 ms 1 /classes/stock/StockAvailable.php:453
229 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2521 AND id_shop=1 LIMIT 1
 0.307 ms 1 /classes/Product.php:6884
323 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.307 ms 1 /classes/Product.php:5670
531 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1973
 0.307 ms 1 /classes/Product.php:2899
166 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2427 AND id_shop=1 LIMIT 1
 0.307 ms 1 /classes/Product.php:6884
352 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1994 LIMIT 1
 0.307 ms 1 /classes/SpecificPrice.php:435
318 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1867 AND `id_group` = 1 LIMIT 1
 0.306 ms 0 /classes/GroupReduction.php:153
139 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 718
AND image_shop.`cover` = 1 LIMIT 1
 0.306 ms 1 /classes/Product.php:3570
351 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.306 ms 1 /classes/Product.php:5670
101 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 690 AND id_shop=1 LIMIT 1
 0.305 ms 1 /classes/Product.php:6884
206 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2662 LIMIT 1
 0.305 ms 1 /classes/SpecificPrice.php:435
246 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.304 ms 0 /classes/SpecificPrice.php:256
195 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.302 ms 1 /classes/Product.php:5670
549 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2321
 0.302 ms 1 /classes/Product.php:2899
709 
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c LEFT JOIN och438iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 22 AND s.id_shop = 1 LIMIT 1
 0.302 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
179 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2428) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.302 ms 1 /classes/stock/StockAvailable.php:453
315 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1867 LIMIT 1
 0.302 ms 1 /classes/SpecificPrice.php:435
430 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2499) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.302 ms 1 /classes/stock/StockAvailable.php:453
718 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcontactpage" LIMIT 1
 0.302 ms 1 /classes/module/Module.php:2664
196 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 756 LIMIT 1
 0.301 ms 1 /classes/SpecificPrice.php:435
219 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1168) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.300 ms 1 /classes/stock/StockAvailable.php:453
198 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 756 AND id_shop=1 LIMIT 1
 0.300 ms 1 /classes/Product.php:6884
334 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1973 LIMIT 1
 0.300 ms 1 /classes/SpecificPrice.php:435
469 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 693
 0.300 ms 1 /classes/Product.php:2899
127 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `id_product` != 0 LIMIT 1
 0.299 ms 521 /classes/SpecificPrice.php:297
258 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1374 AND id_shop=1 LIMIT 1
 0.299 ms 1 /classes/Product.php:6884
295 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.299 ms 1 /classes/Product.php:5670
459 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.298 ms 1 /classes/stock/StockAvailable.php:453
161 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
 0.297 ms 1 /classes/Product.php:5670
410 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2497 AND id_shop=1 LIMIT 1
 0.296 ms 1 /classes/Product.php:6884
528 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1939
 0.296 ms 1 /classes/Product.php:2899
276 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1719 LIMIT 1
 0.296 ms 1 /classes/SpecificPrice.php:435
230 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2521 AND `id_group` = 1 LIMIT 1
 0.295 ms 0 /classes/GroupReduction.php:153
329 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1939) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.295 ms 1 /classes/stock/StockAvailable.php:453
420 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2498 AND `id_group` = 1 LIMIT 1
 0.294 ms 0 /classes/GroupReduction.php:153
525 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1867
 0.294 ms 1 /classes/Product.php:2899
390 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2321 AND id_shop=1 LIMIT 1
 0.293 ms 1 /classes/Product.php:6884
401 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2349 AND id_shop=1 LIMIT 1
 0.293 ms 1 /classes/Product.php:6884
493 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2662
 0.293 ms 1 /classes/Product.php:2899
397 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2349 LIMIT 1
 0.292 ms 1 /classes/SpecificPrice.php:435
417 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2498 LIMIT 1
 0.292 ms 1 /classes/SpecificPrice.php:435
184 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 33 LIMIT 1
 0.292 ms 1 /classes/Product.php:5670
333 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.292 ms 1 /classes/Product.php:5670
174 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2428
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.291 ms 1 /classes/SpecificPrice.php:256
300 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1709 AND `id_group` = 1 LIMIT 1
 0.291 ms 0 /classes/GroupReduction.php:153
172 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
 0.291 ms 1 /classes/Product.php:5670
118 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 693 AND `id_group` = 1 LIMIT 1
 0.290 ms 0 /classes/GroupReduction.php:153
546 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2320
 0.290 ms 1 /classes/Product.php:2899
564 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2500
 0.290 ms 1 /classes/Product.php:2899
275 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.289 ms 1 /classes/Product.php:5670
157 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2429) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.289 ms 1 /classes/stock/StockAvailable.php:453
354 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1994 AND id_shop=1 LIMIT 1
 0.289 ms 1 /classes/Product.php:6884
265 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1718 LIMIT 1
 0.288 ms 1 /classes/SpecificPrice.php:435
552 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2349
 0.288 ms 1 /classes/Product.php:2899
698 
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2500
 0.288 ms 2 /classes/Product.php:3420
151 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2429 LIMIT 1
 0.287 ms 1 /classes/SpecificPrice.php:435
256 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1374 LIMIT 1
 0.287 ms 1 /classes/SpecificPrice.php:435
411 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2497 AND `id_group` = 1 LIMIT 1
 0.287 ms 0 /classes/GroupReduction.php:153
519 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1709
 0.287 ms 1 /classes/Product.php:2899
205 
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 126
AND `active` = 1 LIMIT 1
 0.287 ms 1 /classes/Manufacturer.php:312
398 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2349
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.286 ms 1 /classes/SpecificPrice.php:256
167 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2427 AND `id_group` = 1 LIMIT 1
 0.286 ms 0 /classes/GroupReduction.php:153
214 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.286 ms 1 /classes/Product.php:5670
239 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1658 AND `id_group` = 1 LIMIT 1
 0.285 ms 0 /classes/GroupReduction.php:153
264 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.285 ms 1 /classes/Product.php:5670
475 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 718
 0.285 ms 1 /classes/Product.php:2899
290 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1335 AND `id_group` = 1 LIMIT 1
 0.284 ms 0 /classes/GroupReduction.php:153
443 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.284 ms 1 /classes/Product.php:5670
324 
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 100
AND `active` = 1 LIMIT 1
 0.284 ms 1 /classes/Manufacturer.php:312
355 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1994 AND `id_group` = 1 LIMIT 1
 0.284 ms 0 /classes/GroupReduction.php:153
402 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2349 AND `id_group` = 1 LIMIT 1
 0.284 ms 0 /classes/GroupReduction.php:153
710 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_categorytree" LIMIT 1
 0.284 ms 1 /classes/module/Module.php:2664
226 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.283 ms 1 /classes/SpecificPrice.php:256
505 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1285
 0.283 ms 1 /classes/Product.php:2899
708 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
 0.283 ms 1 /classes/module/Module.php:2137
721 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
 0.283 ms 1 /classes/module/Module.php:2137
136 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1717) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.282 ms 1 /classes/stock/StockAvailable.php:453
208 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2662 AND id_shop=1 LIMIT 1
 0.282 ms 1 /classes/Product.php:6884
558 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2498
 0.282 ms 1 /classes/Product.php:2899
517 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1335
 0.282 ms 1 /classes/Product.php:2899
173 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2428 LIMIT 1
 0.281 ms 1 /classes/SpecificPrice.php:435
412 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2497) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.281 ms 1 /classes/stock/StockAvailable.php:453
450 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.281 ms 1 /classes/stock/StockAvailable.php:453
561 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2499
 0.281 ms 1 /classes/Product.php:2899
464 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 690
 0.281 ms 1 /classes/Product.php:2899
143 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 718 AND id_shop=1 LIMIT 1
 0.280 ms 1 /classes/Product.php:6884
186 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2433
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.280 ms 1 /classes/SpecificPrice.php:256
200 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 756) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.280 ms 1 /classes/stock/StockAvailable.php:453
190 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2433 AND `id_group` = 1 LIMIT 1
 0.280 ms 0 /classes/GroupReduction.php:153
382 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2320 AND `id_group` = 1 LIMIT 1
 0.280 ms 0 /classes/GroupReduction.php:153
444 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2542 LIMIT 1
 0.279 ms 1 /classes/SpecificPrice.php:435
567 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2542
 0.279 ms 1 /classes/Product.php:2899
155 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2429 AND id_shop=1 LIMIT 1
 0.278 ms 1 /classes/Product.php:6884
162 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2427 LIMIT 1
 0.278 ms 1 /classes/SpecificPrice.php:435
204 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
 0.278 ms 1 /classes/Product.php:5670
251 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.278 ms 1 /classes/stock/StockAvailable.php:453
309 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1866 AND `id_group` = 1 LIMIT 1
 0.278 ms 0 /classes/GroupReduction.php:153
508 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1374
 0.278 ms 1 /classes/Product.php:2899
555 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2497
 0.278 ms 1 /classes/Product.php:2899
719 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.278 ms 1 /classes/module/Module.php:2137
189 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2433 AND id_shop=1 LIMIT 1
 0.277 ms 1 /classes/Product.php:6884
364 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2005 AND `id_group` = 1 LIMIT 1
 0.277 ms 0 /classes/GroupReduction.php:153
496 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1168
 0.277 ms 1 /classes/Product.php:2899
522 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1866
 0.277 ms 1 /classes/Product.php:2899
391 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2321 AND `id_group` = 1 LIMIT 1
 0.276 ms 0 /classes/GroupReduction.php:153
168 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2427) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.275 ms 1 /classes/stock/StockAvailable.php:453
435 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2500 LIMIT 1
 0.275 ms 1 /classes/SpecificPrice.php:435
131 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1717
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.274 ms 0 /classes/SpecificPrice.php:256
511 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1718
 0.274 ms 1 /classes/Product.php:2899
150 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
 0.273 ms 1 /classes/Product.php:5670
271 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1718) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.273 ms 1 /classes/stock/StockAvailable.php:453
277 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1719
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.273 ms 0 /classes/SpecificPrice.php:256
280 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1719 AND id_shop=1 LIMIT 1
 0.273 ms 1 /classes/Product.php:6884
472 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1717
 0.273 ms 1 /classes/Product.php:2899
448 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2542 AND id_shop=1 LIMIT 1
 0.272 ms 1 /classes/Product.php:6884
499 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2521
 0.272 ms 1 /classes/Product.php:2899
163 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2427
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.271 ms 1 /classes/SpecificPrice.php:256
215 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1168 LIMIT 1
 0.271 ms 1 /classes/SpecificPrice.php:435
106 
SELECT SQL_NO_CACHE *
FROM `och438tax_lang`
WHERE `id_tax` = 31
 0.270 ms 1 /src/Adapter/EntityMapper.php:79
537 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1994
 0.270 ms 1 /classes/Product.php:2899
97 
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 6
AND `active` = 1 LIMIT 1
 0.270 ms 1 /classes/Manufacturer.php:312
325 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1939 LIMIT 1
 0.270 ms 1 /classes/SpecificPrice.php:435
466 
SELECT SQL_NO_CACHE * FROM `och438image_type`
 0.270 ms 8 /classes/ImageType.php:161
445 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.269 ms 1 /classes/SpecificPrice.php:256
117 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 693 AND id_shop=1 LIMIT 1
 0.269 ms 1 /classes/Product.php:6884
199 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 756 AND `id_group` = 1 LIMIT 1
 0.269 ms 0 /classes/GroupReduction.php:153
114 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.268 ms 1 /classes/Product.php:5670
140 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.268 ms 1 /classes/Product.php:5670
209 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2662 AND `id_group` = 1 LIMIT 1
 0.267 ms 0 /classes/GroupReduction.php:153
224 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
 0.267 ms 1 /classes/Product.php:5670
255 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.267 ms 1 /classes/Product.php:5670
328 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1939 AND `id_group` = 1 LIMIT 1
 0.267 ms 0 /classes/GroupReduction.php:153
455 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2543 LIMIT 1
 0.267 ms 1 /classes/SpecificPrice.php:435
260 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1374) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.266 ms 1 /classes/stock/StockAvailable.php:453
425 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.266 ms 1 /classes/Product.php:5670
543 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2007
 0.266 ms 1 /classes/Product.php:2899
369 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.265 ms 1 /classes/Product.php:5670
454 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.264 ms 1 /classes/Product.php:5670
178 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2428 AND `id_group` = 1 LIMIT 1
 0.264 ms 0 /classes/GroupReduction.php:153
225 
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2521 LIMIT 1
 0.264 ms 1 /classes/SpecificPrice.php:435
434 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
 0.264 ms 1 /classes/Product.php:5670
327 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1939 AND id_shop=1 LIMIT 1
 0.263 ms 1 /classes/Product.php:6884
502 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1658
 0.263 ms 1 /classes/Product.php:2899
716 
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c
WHERE c.`id_category` = 2 LIMIT 1
 0.263 ms 1 /classes/Category.php:1589
217 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1168 AND id_shop=1 LIMIT 1
 0.262 ms 1 /classes/Product.php:6884
269 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1718 AND id_shop=1 LIMIT 1
 0.262 ms 1 /classes/Product.php:6884
449 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2542 AND `id_group` = 1 LIMIT 1
 0.260 ms 0 /classes/GroupReduction.php:153
534 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1974
 0.260 ms 1 /classes/Product.php:2899
540 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2005
 0.258 ms 1 /classes/Product.php:2899
249 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1285 AND id_shop=1 LIMIT 1
 0.257 ms 1 /classes/Product.php:6884
428 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2499 AND id_shop=1 LIMIT 1
 0.256 ms 1 /classes/Product.php:6884
437 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2500 AND id_shop=1 LIMIT 1
 0.256 ms 1 /classes/Product.php:6884
266 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1718
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.256 ms 0 /classes/SpecificPrice.php:256
457 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2543 AND id_shop=1 LIMIT 1
 0.256 ms 1 /classes/Product.php:6884
723 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1
 0.255 ms 1 /classes/module/Module.php:2137
177 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2428 AND id_shop=1 LIMIT 1
 0.254 ms 1 /classes/Product.php:6884
429 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2499 AND `id_group` = 1 LIMIT 1
 0.253 ms 0 /classes/GroupReduction.php:153
134 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1717 AND id_shop=1 LIMIT 1
 0.252 ms 1 /classes/Product.php:6884
218 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1168 AND `id_group` = 1 LIMIT 1
 0.251 ms 0 /classes/GroupReduction.php:153
250 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1285 AND `id_group` = 1 LIMIT 1
 0.251 ms 0 /classes/GroupReduction.php:153
725 
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
 0.251 ms 1 /classes/module/Module.php:2137
124 
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 130 LIMIT 1
 0.249 ms 1 /classes/Product.php:5670
144 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 718 AND `id_group` = 1 LIMIT 1
 0.249 ms 0 /classes/GroupReduction.php:153
156 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2429 AND `id_group` = 1 LIMIT 1
 0.248 ms 0 /classes/GroupReduction.php:153
259 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1374 AND `id_group` = 1 LIMIT 1
 0.248 ms 0 /classes/GroupReduction.php:153
125 
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 70
AND `active` = 1 LIMIT 1
 0.247 ms 1 /classes/Manufacturer.php:312
135 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1717 AND `id_group` = 1 LIMIT 1
 0.247 ms 0 /classes/GroupReduction.php:153
281 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1719 AND `id_group` = 1 LIMIT 1
 0.247 ms 0 /classes/GroupReduction.php:153
270 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1718 AND `id_group` = 1 LIMIT 1
 0.245 ms 0 /classes/GroupReduction.php:153
724 
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcookielaw" LIMIT 1
 0.245 ms 1 /classes/module/Module.php:2664
438 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2500 AND `id_group` = 1 LIMIT 1
 0.239 ms 0 /classes/GroupReduction.php:153
458 
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2543 AND `id_group` = 1 LIMIT 1
 0.239 ms 0 /classes/GroupReduction.php:153

Doubles

37 queries 
SELECT XX FROM `ochXXspecific_price` WHERE id_product = XX LIMIT XX
36 queries 
SELECT image_shop.`id_image`
                    FROM `ochXXimage` i
                     INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
36 queries 
SELECT name FROM ochXXcategory_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
36 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ochXXproduct` p
INNER JOIN `ochXXproduct_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `ochXXproduct_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
36 queries 
                            SELECT `id_tax_rules_group`
                            FROM `ochXXproduct_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
36 queries 
			SELECT `reduction`
			FROM `ochXXproduct_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
36 queries 
SELECT SUM(quantity)
FROM `ochXXstock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
36 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `ochXXcart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `ochXXcart_product` cp JOIN `ochXXpack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ochXXproduct` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
36 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM ochXXfeature_product pf
                LEFT JOIN ochXXfeature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN ochXXfeature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN ochXXfeature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN ochXXfeature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
36 queries 
SELECT *
FROM `ochXXproduct` a
LEFT JOIN `ochXXproduct_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `ochXXproduct_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
36 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `ochXXimage` i
             INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `ochXXimage_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
36 queries 
SELECT `id_product_attribute`
            FROM `ochXXproduct_attribute`
            WHERE `id_product` = XX
36 queries 
                SELECT `id_category` FROM `ochXXcategory_product`
                WHERE `id_product` = XX
36 queries 
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `ochXXiqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
36 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `ochXXproduct_attribute` pa
             INNER JOIN ochXXproduct_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `ochXXproduct_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `ochXXattribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `ochXXattribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
18 queries 
SELECT *
FROM `ochXXcategory` a
LEFT JOIN `ochXXcategory_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `ochXXcategory_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
18 queries 
SELECT `id_module` FROM `ochXXmodule_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
11 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `ochXXspecific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
11 queries 
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `ochXXspecific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
5 queries 
			SELECT cl.`link_rewrite`
			FROM `ochXXcategory_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries 
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `ochXXattribute_group` ag INNER JOIN `ochXXattribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `ochXXattribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN ochXXattribute_group_shop attribute_group_shop
        ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX)  INNER JOIN ochXXattribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `ochXXlayered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
4 queries 
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN ochXXattribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
4 queries 
				SELECT `name`
				FROM `ochXXmanufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries 
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `ochXXmodule` m
                LEFT JOIN `ochXXmodule_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries 
SELECT `id_lang` FROM `ochXXlang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
2 queries 
		SELECT `id_category`
		FROM `ochXXcategory_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries 
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `ochXXmanufacturer` m INNER JOIN ochXXmanufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `ochXXmanufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
2 queries 
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN ochXXfeature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
2 queries 
				SELECT tr.*
				FROM `ochXXtax_rule` tr
				JOIN `ochXXtax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
SELECT XX FROM `ochXXcart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

123 product
123 product_shop
88 product_attribute
74 cart_product
72 image
72 image_shop
72 product_attribute_shop
68 category_lang
53 specific_price
52 product_attribute_combination
52 category_product
49 stock_available
44 attribute
43 category
41 attribute_group
40 attribute_lang
38 feature_product
37 feature
37 feature_shop
37 feature_lang
37 product_lang
36 product_group_reduction_cache
36 pack
36 feature_value_lang
36 image_lang
36 iqitreviews_products
25 category_shop
22 module
21 module_shop
17 category_group
12 product_sale
11 specific_price_priority
7 hook
6 manufacturer
5 lang
5 currency
5 attribute_group_shop
5 attribute_group_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 attribute_shop
4 layered_indexable_attribute_lang_value
3 country
3 hook_alias
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 manufacturer_shop
2 manufacturer_lang
2 tax_rule
2 tax_rules_group
2 iqit_elementor_category
2 cart_rule
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 layered_category
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 tax
1 tax_lang
1 feature_flag
1 iqit_elementor_category_shop
1 connections
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 38 /classes/Link.php:113 (__construct) [id: 1709]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 690]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 693]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1717]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 718]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2429]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2427]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2428]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2433]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 756]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2662]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1168]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2521]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1658]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1285]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1374]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1718]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1719]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1335]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1709]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1866]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1867]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1939]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1973]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1974]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1994]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2005]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2007]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2320]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2321]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2349]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2497]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2498]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2499]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2500]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2542]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2543]
/classes/Link.php:113 (__construct) [id: 1709]
Category 23 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 22]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 26]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 29]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 41]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 42]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 43]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 45]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 94]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 130]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 131]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 138]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 272]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 274]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 275]
/classes/Meta.php:379 (__construct) [id: 22]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 22]
/modules/ps_facetedsearch/src/Filters/Block.php:158 (__construct) [id: 22]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1768 (__construct) [id: 0]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Tax 1 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 31]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /classes/Smarty/SmartyDev.php
199 /vendor/smarty/smarty/libs/Smarty.class.php
200 /vendor/smarty/smarty/libs/functions.php
201 /vendor/smarty/smarty/libs/Autoloader.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
211 /config/smartyfront.config.inc.php
212 /classes/Smarty/SmartyResourceModule.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
215 /classes/Smarty/SmartyResourceParent.php
216 /classes/Smarty/SmartyLazyRegister.php
217 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
218 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
219 /classes/Customer.php
220 /classes/Group.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /classes/Dispatcher.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
231 /src/Adapter/SymfonyContainer.php
232 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
233 /src/Adapter/ContainerBuilder.php
234 /src/Adapter/Environment.php
235 /src/Core/EnvironmentInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
237 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
238 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
239 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
240 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
241 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
245 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
246 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
247 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
248 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
249 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
250 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
252 /vendor/symfony/contracts/Service/ResetInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
255 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
256 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
258 /vendor/symfony/contracts/Cache/ItemInterface.php
259 /vendor/psr/cache/src/CacheItemInterface.php
260 /vendor/psr/cache/src/CacheItemPoolInterface.php
261 /vendor/symfony/contracts/Cache/CacheInterface.php
262 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
264 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
266 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
267 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
268 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
269 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
270 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
271 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
319 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
321 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
323 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
324 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
325 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
326 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
330 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
331 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
332 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
333 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
334 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
335 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
336 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
337 /var/cache/dev/FrontContainer.php
338 /src/Adapter/Container/LegacyContainer.php
339 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
340 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
341 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
342 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
343 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
344 /vendor/psr/container/src/ContainerExceptionInterface.php
345 /vendor/psr/container/src/NotFoundExceptionInterface.php
346 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
347 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
348 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
349 /src/Adapter/Container/LegacyContainerInterface.php
350 /modules/blockwishlist/vendor/autoload.php
351 /modules/blockwishlist/vendor/composer/autoload_real.php
352 /modules/blockwishlist/vendor/composer/autoload_static.php
353 /modules/contactform/vendor/autoload.php
354 /modules/contactform/vendor/composer/autoload_real.php
355 /modules/contactform/vendor/composer/autoload_static.php
356 /modules/dashactivity/vendor/autoload.php
357 /modules/dashactivity/vendor/composer/autoload_real.php
358 /modules/dashactivity/vendor/composer/platform_check.php
359 /modules/dashactivity/vendor/composer/autoload_static.php
360 /modules/dashtrends/vendor/autoload.php
361 /modules/dashtrends/vendor/composer/autoload_real.php
362 /modules/dashtrends/vendor/composer/autoload_static.php
363 /modules/dashgoals/vendor/autoload.php
364 /modules/dashgoals/vendor/composer/autoload_real.php
365 /modules/dashgoals/vendor/composer/platform_check.php
366 /modules/dashgoals/vendor/composer/autoload_static.php
367 /modules/dashproducts/vendor/autoload.php
368 /modules/dashproducts/vendor/composer/autoload_real.php
369 /modules/dashproducts/vendor/composer/platform_check.php
370 /modules/dashproducts/vendor/composer/autoload_static.php
371 /modules/graphnvd3/vendor/autoload.php
372 /modules/graphnvd3/vendor/composer/autoload_real.php
373 /modules/graphnvd3/vendor/composer/autoload_static.php
374 /modules/gridhtml/vendor/autoload.php
375 /modules/gridhtml/vendor/composer/autoload_real.php
376 /modules/gridhtml/vendor/composer/autoload_static.php
377 /modules/gsitemap/vendor/autoload.php
378 /modules/gsitemap/vendor/composer/autoload_real.php
379 /modules/gsitemap/vendor/composer/platform_check.php
380 /modules/gsitemap/vendor/composer/autoload_static.php
381 /modules/pagesnotfound/vendor/autoload.php
382 /modules/pagesnotfound/vendor/composer/autoload_real.php
383 /modules/pagesnotfound/vendor/composer/platform_check.php
384 /modules/pagesnotfound/vendor/composer/autoload_static.php
385 /modules/productcomments/vendor/autoload.php
386 /modules/productcomments/vendor/composer/autoload_real.php
387 /modules/productcomments/vendor/composer/platform_check.php
388 /modules/productcomments/vendor/composer/autoload_static.php
389 /modules/ps_categorytree/vendor/autoload.php
390 /modules/ps_categorytree/vendor/composer/autoload_real.php
391 /modules/ps_categorytree/vendor/composer/platform_check.php
392 /modules/ps_categorytree/vendor/composer/autoload_static.php
393 /modules/ps_checkpayment/vendor/autoload.php
394 /modules/ps_checkpayment/vendor/composer/autoload_real.php
395 /modules/ps_checkpayment/vendor/composer/autoload_static.php
396 /modules/ps_crossselling/vendor/autoload.php
397 /modules/ps_crossselling/vendor/composer/autoload_real.php
398 /modules/ps_crossselling/vendor/composer/platform_check.php
399 /modules/ps_crossselling/vendor/composer/autoload_static.php
400 /modules/ps_currencyselector/vendor/autoload.php
401 /modules/ps_currencyselector/vendor/composer/autoload_real.php
402 /modules/ps_currencyselector/vendor/composer/autoload_static.php
403 /modules/ps_customeraccountlinks/vendor/autoload.php
404 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
405 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
406 /modules/ps_customersignin/vendor/autoload.php
407 /modules/ps_customersignin/vendor/composer/autoload_real.php
408 /modules/ps_customersignin/vendor/composer/autoload_static.php
409 /modules/ps_dataprivacy/vendor/autoload.php
410 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
411 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
412 /modules/ps_emailsubscription/vendor/autoload.php
413 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
414 /modules/ps_emailsubscription/vendor/composer/platform_check.php
415 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
416 /modules/ps_faviconnotificationbo/vendor/autoload.php
417 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
418 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
419 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
420 /modules/ps_languageselector/vendor/autoload.php
421 /modules/ps_languageselector/vendor/composer/autoload_real.php
422 /modules/ps_languageselector/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_wirepayment/vendor/autoload.php
430 /modules/ps_wirepayment/vendor/composer/autoload_real.php
431 /modules/ps_wirepayment/vendor/composer/platform_check.php
432 /modules/ps_wirepayment/vendor/composer/autoload_static.php
433 /modules/statsbestcategories/vendor/autoload.php
434 /modules/statsbestcategories/vendor/composer/autoload_real.php
435 /modules/statsbestcategories/vendor/composer/platform_check.php
436 /modules/statsbestcategories/vendor/composer/autoload_static.php
437 /modules/statsbestcustomers/vendor/autoload.php
438 /modules/statsbestcustomers/vendor/composer/autoload_real.php
439 /modules/statsbestcustomers/vendor/composer/platform_check.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestproducts/vendor/autoload.php
442 /modules/statsbestproducts/vendor/composer/autoload_real.php
443 /modules/statsbestproducts/vendor/composer/platform_check.php
444 /modules/statsbestproducts/vendor/composer/autoload_static.php
445 /modules/statsbestsuppliers/vendor/autoload.php
446 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
447 /modules/statsbestsuppliers/vendor/composer/platform_check.php
448 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
449 /modules/statsbestvouchers/vendor/autoload.php
450 /modules/statsbestvouchers/vendor/composer/autoload_real.php
451 /modules/statsbestvouchers/vendor/composer/platform_check.php
452 /modules/statsbestvouchers/vendor/composer/autoload_static.php
453 /modules/statscarrier/vendor/autoload.php
454 /modules/statscarrier/vendor/composer/autoload_real.php
455 /modules/statscarrier/vendor/composer/platform_check.php
456 /modules/statscarrier/vendor/composer/autoload_static.php
457 /modules/statscatalog/vendor/autoload.php
458 /modules/statscatalog/vendor/composer/autoload_real.php
459 /modules/statscatalog/vendor/composer/platform_check.php
460 /modules/statscatalog/vendor/composer/autoload_static.php
461 /modules/statscheckup/vendor/autoload.php
462 /modules/statscheckup/vendor/composer/autoload_real.php
463 /modules/statscheckup/vendor/composer/platform_check.php
464 /modules/statscheckup/vendor/composer/autoload_static.php
465 /modules/statsdata/vendor/autoload.php
466 /modules/statsdata/vendor/composer/autoload_real.php
467 /modules/statsdata/vendor/composer/autoload_static.php
468 /modules/statsforecast/vendor/autoload.php
469 /modules/statsforecast/vendor/composer/autoload_real.php
470 /modules/statsforecast/vendor/composer/platform_check.php
471 /modules/statsforecast/vendor/composer/autoload_static.php
472 /modules/statsnewsletter/vendor/autoload.php
473 /modules/statsnewsletter/vendor/composer/autoload_real.php
474 /modules/statsnewsletter/vendor/composer/platform_check.php
475 /modules/statsnewsletter/vendor/composer/autoload_static.php
476 /modules/statspersonalinfos/vendor/autoload.php
477 /modules/statspersonalinfos/vendor/composer/autoload_real.php
478 /modules/statspersonalinfos/vendor/composer/platform_check.php
479 /modules/statspersonalinfos/vendor/composer/autoload_static.php
480 /modules/statsproduct/vendor/autoload.php
481 /modules/statsproduct/vendor/composer/autoload_real.php
482 /modules/statsproduct/vendor/composer/platform_check.php
483 /modules/statsproduct/vendor/composer/autoload_static.php
484 /modules/statsregistrations/vendor/autoload.php
485 /modules/statsregistrations/vendor/composer/autoload_real.php
486 /modules/statsregistrations/vendor/composer/platform_check.php
487 /modules/statsregistrations/vendor/composer/autoload_static.php
488 /modules/statssales/vendor/autoload.php
489 /modules/statssales/vendor/composer/autoload_real.php
490 /modules/statssales/vendor/composer/platform_check.php
491 /modules/statssales/vendor/composer/autoload_static.php
492 /modules/statssearch/vendor/autoload.php
493 /modules/statssearch/vendor/composer/autoload_real.php
494 /modules/statssearch/vendor/composer/platform_check.php
495 /modules/statssearch/vendor/composer/autoload_static.php
496 /modules/statsstock/vendor/autoload.php
497 /modules/statsstock/vendor/composer/autoload_real.php
498 /modules/statsstock/vendor/composer/platform_check.php
499 /modules/statsstock/vendor/composer/autoload_static.php
500 /modules/psgdpr/vendor/autoload.php
501 /modules/psgdpr/vendor/composer/autoload_real.php
502 /modules/psgdpr/vendor/composer/autoload_static.php
503 /modules/ps_facetedsearch/vendor/autoload.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
505 /modules/ps_facetedsearch/vendor/composer/platform_check.php
506 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
507 /modules/iqitsociallogin/vendor/autoload.php
508 /modules/iqitsociallogin/vendor/composer/autoload_real.php
509 /modules/iqitsociallogin/vendor/composer/platform_check.php
510 /modules/iqitsociallogin/vendor/composer/autoload_static.php
511 /modules/ps_emailalerts/vendor/autoload.php
512 /modules/ps_emailalerts/vendor/composer/autoload_real.php
513 /modules/ps_emailalerts/vendor/composer/autoload_static.php
514 /modules/ps_googleanalytics/vendor/autoload.php
515 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
516 /modules/ps_googleanalytics/vendor/composer/platform_check.php
517 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
518 /modules/ph_simpleblog/vendor/autoload.php
519 /modules/ph_simpleblog/vendor/composer/autoload_real.php
520 /modules/ph_simpleblog/vendor/composer/platform_check.php
521 /modules/ph_simpleblog/vendor/composer/autoload_static.php
522 /modules/autoupgrade/vendor/autoload.php
523 /modules/autoupgrade/vendor/composer/autoload_real.php
524 /modules/autoupgrade/vendor/composer/autoload_static.php
525 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
526 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
527 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
528 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
529 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
530 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
531 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
532 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
533 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
534 /modules/iqitproductflags/vendor/autoload.php
535 /modules/iqitproductflags/vendor/composer/autoload_real.php
536 /modules/iqitproductflags/vendor/composer/platform_check.php
537 /modules/iqitproductflags/vendor/composer/autoload_static.php
538 /modules/iqitproductvariants/vendor/autoload.php
539 /modules/iqitproductvariants/vendor/composer/autoload_real.php
540 /modules/iqitproductvariants/vendor/composer/autoload_static.php
541 /src/Core/Hook/HookModuleFilter.php
542 /src/Core/Hook/HookModuleFilterInterface.php
543 /modules/ph_simpleblog/ph_simpleblog.php
544 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
545 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
546 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
547 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
548 /modules/ph_simpleblog/models/SimpleBlogCategory.php
549 /modules/ph_simpleblog/models/SimpleBlogPost.php
550 /modules/ph_simpleblog/models/SimpleBlogPostType.php
551 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
552 /modules/ph_simpleblog/models/SimpleBlogTag.php
553 /modules/ph_simpleblog/models/SimpleBlogComment.php
554 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
555 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
556 /modules/ph_simpleblog/classes/BlogPostsFinder.php
557 /modules/ph_simpleblog/controllers/front/default_list.php
558 /classes/controller/ModuleFrontController.php
559 /override/classes/controller/FrontController.php
560 /classes/controller/FrontController.php
561 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
562 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
563 /classes/Translate.php
564 /modules/ph_simpleblog/translations/es.php
565 /src/PrestaShopBundle/Translation/TranslatorComponent.php
566 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
567 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
568 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
569 /vendor/symfony/contracts/Translation/TranslatorInterface.php
570 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
571 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
572 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
573 /src/PrestaShopBundle/Translation/TranslatorInterface.php
574 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
575 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
576 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
577 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
578 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
579 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
580 /vendor/symfony/contracts/Translation/TranslatorTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
582 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
583 /var/cache/dev/translations/catalogue.es-ES.NXhscRe.php
584 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
585 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
587 /controllers/front/listing/CategoryController.php
588 /classes/controller/ProductListingFrontController.php
589 /classes/controller/ProductPresentingFrontController.php
590 /src/Adapter/Presenter/Object/ObjectPresenter.php
591 /src/Adapter/Presenter/PresenterInterface.php
592 /src/Adapter/Presenter/Cart/CartPresenter.php
593 /src/Adapter/Image/ImageRetriever.php
594 /classes/tax/TaxConfiguration.php
595 /classes/Smarty/TemplateFinder.php
596 /classes/assets/StylesheetManager.php
597 /classes/assets/AbstractAssetManager.php
598 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
599 /classes/assets/JavascriptManager.php
600 /classes/assets/CccReducer.php
601 /modules/iqitthemeeditor/iqitthemeeditor.php
602 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
603 /modules/iqitthemeeditor/translations/es.php
604 /classes/Category.php
605 /classes/webservice/WebserviceRequest.php
606 /src/Core/Localization/Locale/Repository.php
607 /src/Core/Localization/Locale/RepositoryInterface.php
608 /src/Core/Localization/CLDR/LocaleRepository.php
609 /src/Core/Localization/CLDR/LocaleDataSource.php
610 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
611 /src/Core/Data/Layer/AbstractDataLayer.php
612 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
613 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
614 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
615 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
616 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
617 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
618 /vendor/symfony/contracts/Cache/CacheTrait.php
619 /vendor/psr/cache/src/InvalidArgumentException.php
620 /vendor/psr/cache/src/CacheException.php
621 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
622 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
623 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
624 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
625 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
626 /src/Core/Localization/CLDR/Reader.php
627 /src/Core/Localization/CLDR/ReaderInterface.php
628 /src/Core/Localization/Currency/Repository.php
629 /src/Core/Localization/Currency/RepositoryInterface.php
630 /src/Core/Localization/Currency/CurrencyDataSource.php
631 /src/Core/Localization/Currency/DataSourceInterface.php
632 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
633 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
634 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
635 /src/Adapter/Currency/CurrencyDataProvider.php
636 /src/Core/Currency/CurrencyDataProviderInterface.php
637 /src/Adapter/LegacyContext.php
638 /src/Adapter/Tools.php
639 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
640 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
641 /vendor/prestashop/decimal/src/Operation/Rounding.php
642 /src/Core/Localization/Locale.php
643 /src/Core/Localization/LocaleInterface.php
644 /src/Core/Localization/Specification/Price.php
645 /src/Core/Localization/Specification/Number.php
646 /src/Core/Localization/Specification/NumberInterface.php
647 /src/Core/Localization/Specification/Factory.php
648 /src/Core/Localization/CLDR/LocaleData.php
649 /src/Core/Localization/CLDR/NumberSymbolsData.php
650 /src/Core/Localization/CLDR/CurrencyData.php
651 /src/Core/Localization/CLDR/Locale.php
652 /src/Core/Localization/CLDR/LocaleInterface.php
653 /src/Core/Localization/Specification/NumberSymbolList.php
654 /classes/Currency.php
655 /src/Core/Localization/Currency/LocalizedCurrencyId.php
656 /src/Core/Localization/Currency/CurrencyData.php
657 /src/Core/Localization/Currency/CurrencyCollection.php
658 /src/Core/Localization/Currency.php
659 /src/Core/Localization/CurrencyInterface.php
660 /src/Core/Localization/Specification/NumberCollection.php
661 /src/Core/Localization/Number/Formatter.php
662 /override/classes/Cart.php
663 /classes/Cart.php
664 /src/Adapter/AddressFactory.php
665 /override/classes/CartRule.php
666 /classes/CartRule.php
667 /classes/Product.php
668 /src/Core/Domain/Product/ValueObject/RedirectType.php
669 /src/Core/Util/DateTime/DateTime.php
670 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
671 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
672 /src/Core/Domain/Product/ValueObject/ProductType.php
673 /src/Core/Domain/Product/ValueObject/Reference.php
674 /src/Core/Domain/Product/ValueObject/Ean13.php
675 /src/Core/Domain/Product/ValueObject/Isbn.php
676 /src/Core/Domain/Product/ValueObject/Upc.php
677 /src/Core/Domain/Product/ProductSettings.php
678 /src/Core/Domain/Shop/ValueObject/ShopId.php
679 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
680 /modules/ps_emailsubscription/ps_emailsubscription.php
681 /src/Core/Module/WidgetInterface.php
682 /src/PrestaShopBundle/Translation/DomainNormalizer.php
683 /classes/Media.php
684 /modules/ps_emailalerts/ps_emailalerts.php
685 /modules/ps_emailalerts/MailAlert.php
686 /modules/iqitproductvariants/iqitproductvariants.php
687 /src/Adapter/Localization/LegacyTranslator.php
688 /src/Adapter/Presenter/Cart/CartLazyArray.php
689 /src/Adapter/Presenter/AbstractLazyArray.php
690 /src/Adapter/Product/PriceFormatter.php
691 /src/Core/Util/Inflector.php
692 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
693 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
694 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
695 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
696 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
697 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
698 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
699 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
700 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
701 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
702 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
703 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
704 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
705 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
706 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
707 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
708 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
709 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
710 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
711 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
712 /classes/Gender.php
713 /classes/Risk.php
714 /classes/Meta.php
715 /modules/revsliderprestashop/revsliderprestashop.php
716 /modules/revsliderprestashop/rev-loader.php
717 /modules/revsliderprestashop/includes/revslider_db.class.php
718 /modules/revsliderprestashop/includes/data.class.php
719 /modules/revsliderprestashop/includes/functions.class.php
720 /modules/revsliderprestashop/includes/em-integration.class.php
721 /modules/revsliderprestashop/includes/cssparser.class.php
722 /modules/revsliderprestashop/includes/woocommerce.class.php
723 /modules/revsliderprestashop/includes/wpml.class.php
724 /modules/revsliderprestashop/includes/colorpicker.class.php
725 /modules/revsliderprestashop/includes/navigation.class.php
726 /modules/revsliderprestashop/includes/object-library.class.php
727 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
728 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
729 /modules/revsliderprestashop/includes/extension.class.php
730 /modules/revsliderprestashop/includes/favorite.class.php
731 /modules/revsliderprestashop/includes/aq-resizer.class.php
732 /modules/revsliderprestashop/includes/external-sources.class.php
733 /modules/revsliderprestashop/includes/page-template.class.php
734 /modules/revsliderprestashop/includes/slider.class.php
735 /modules/revsliderprestashop/includes/slide.class.php
736 /modules/revsliderprestashop/includes/output.class.php
737 /modules/revsliderprestashop/public/revslider-front.class.php
738 /modules/revsliderprestashop/includes/backwards.php
739 /modules/revsliderprestashop/admin/includes/class-pclzip.php
740 /modules/revsliderprestashop/admin/includes/license.class.php
741 /modules/revsliderprestashop/admin/includes/addons.class.php
742 /modules/revsliderprestashop/admin/includes/template.class.php
743 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
744 /modules/revsliderprestashop/admin/includes/folder.class.php
745 /modules/revsliderprestashop/admin/includes/import.class.php
746 /modules/revsliderprestashop/admin/includes/export.class.php
747 /modules/revsliderprestashop/admin/includes/export-html.class.php
748 /modules/revsliderprestashop/admin/includes/newsletter.class.php
749 /modules/revsliderprestashop/admin/revslider-admin.class.php
750 /modules/revsliderprestashop/includes/update.class.php
751 /modules/revsliderprestashop/includes/resize-imag.php
752 /modules/revsliderprestashop/translations/es.php
753 /classes/Address.php
754 /classes/ImageType.php
755 /classes/State.php
756 /src/Core/Security/PasswordPolicyConfiguration.php
757 /src/Core/Configuration/DataConfigurationInterface.php
758 /src/Core/Filter/FrontEndObject/MainFilter.php
759 /src/Core/Filter/FilterInterface.php
760 /src/Core/Filter/FrontEndObject/CartFilter.php
761 /src/Core/Filter/HashMapWhitelistFilter.php
762 /src/Core/Filter/CollectionFilter.php
763 /src/Core/Filter/FrontEndObject/ProductFilter.php
764 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
765 /src/Core/Filter/FrontEndObject/CustomerFilter.php
766 /src/Core/Filter/FrontEndObject/ShopFilter.php
767 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
768 /modules/productcomments/productcomments.php
769 /modules/ps_shoppingcart/ps_shoppingcart.php
770 /modules/iqitcontactpage/iqitcontactpage.php
771 /modules/iqitcontactpage/translations/es.php
772 /modules/iqitcookielaw/iqitcookielaw.php
773 /modules/iqitcookielaw/translations/es.php
774 /modules/iqitcountdown/iqitcountdown.php
775 /modules/iqitcountdown/translations/es.php
776 /modules/iqitsociallogin/iqitsociallogin.php
777 /modules/iqitsociallogin/translations/es.php
778 /modules/ps_googleanalytics/ps_googleanalytics.php
779 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
780 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
781 /classes/Smarty/SmartyDevTemplate.php
782 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
783 /var/cache/dev/smarty/compile/warehouse/7f/93/a7/7f93a70bcc26a0e15d5a8f0ad7b21b4b42ad15c2_2.file.ps_googleanalytics.tpl.php
784 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
785 /classes/assets/PrestashopAssetsLibraries.php
786 /modules/iqitsizecharts/iqitsizecharts.php
787 /modules/iqitsizecharts/src/IqitSizeCharts.php
788 /modules/iqitsizecharts/translations/es.php
789 /modules/iqitwishlist/iqitwishlist.php
790 /modules/iqitwishlist/src/IqitWishlistProduct.php
791 /modules/iqitwishlist/translations/es.php
792 /modules/iqitreviews/iqitreviews.php
793 /modules/iqitreviews/src/IqitProductReview.php
794 /modules/iqitreviews/translations/es.php
795 /modules/iqitpopup/iqitpopup.php
796 /modules/iqitpopup/translations/es.php
797 /modules/iqitmegamenu/iqitmegamenu.php
798 /modules/iqitmegamenu/models/IqitMenuTab.php
799 /modules/iqitmegamenu/models/IqitMenuHtml.php
800 /modules/iqitmegamenu/models/IqitMenuLinks.php
801 /modules/iqitmegamenu/translations/es.php
802 /modules/iqitcompare/iqitcompare.php
803 /modules/iqitcompare/translations/es.php
804 /modules/iqitelementor/iqitelementor.php
805 /modules/iqitelementor/src/IqitElementorLanding.php
806 /modules/iqitelementor/src/IqitElementorTemplate.php
807 /modules/iqitelementor/src/IqitElementorProduct.php
808 /modules/iqitelementor/src/IqitElementorCategory.php
809 /modules/iqitelementor/src/IqitElementorContent.php
810 /modules/iqitelementor/src/iqitElementorWpHelper.php
811 /modules/iqitelementor/includes/plugin-elementor.php
812 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
813 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
814 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
815 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
816 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
817 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
818 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
819 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
820 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
821 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
822 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
823 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
824 /modules/iqitelementor/translations/es.php
825 /modules/iqitextendedproduct/iqitextendedproduct.php
826 /modules/iqitextendedproduct/src/IqitThreeSixty.php
827 /modules/iqitextendedproduct/src/IqitProductVideo.php
828 /modules/iqitextendedproduct/translations/es.php
829 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
830 /modules/iqitfreedeliverycount/translations/es.php
831 /src/Core/Product/Search/ProductSearchContext.php
832 /src/Core/Product/Search/ProductSearchQuery.php
833 /src/Core/Product/Search/SortOrder.php
834 /modules/ps_facetedsearch/ps_facetedsearch.php
835 /modules/ps_facetedsearch/src/HookDispatcher.php
836 /modules/ps_facetedsearch/src/Hook/Attribute.php
837 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
838 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
839 /modules/ps_facetedsearch/src/Hook/Category.php
840 /modules/ps_facetedsearch/src/Hook/Configuration.php
841 /modules/ps_facetedsearch/src/Hook/Design.php
842 /modules/ps_facetedsearch/src/Hook/Feature.php
843 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
844 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
845 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
846 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
847 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
848 /modules/ps_facetedsearch/src/Hook/Product.php
849 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
850 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
851 /modules/ps_facetedsearch/src/Filters/Provider.php
852 /modules/ps_facetedsearch/src/URLSerializer.php
853 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
854 /modules/ps_facetedsearch/src/Product/SearchProvider.php
855 /src/Core/Product/Search/FacetsRendererInterface.php
856 /src/Core/Product/Search/ProductSearchProviderInterface.php
857 /modules/ps_facetedsearch/src/Filters/Converter.php
858 /modules/ps_facetedsearch/src/Product/SearchFactory.php
859 /src/Core/Product/Search/ProductSearchResult.php
860 /classes/Combination.php
861 /classes/Manufacturer.php
862 /src/Core/Util/String/StringModifier.php
863 /src/Core/Util/String/StringModifierInterface.php
864 /modules/ps_facetedsearch/src/Product/Search.php
865 /modules/ps_facetedsearch/src/Adapter/MySQL.php
866 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
867 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
868 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
869 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
870 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
871 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
872 /modules/ps_facetedsearch/src/Filters/Products.php
873 /classes/stock/StockAvailable.php
874 /modules/ps_facetedsearch/src/Filters/Block.php
875 /src/Core/Product/Search/Facet.php
876 /src/Core/Product/Search/Filter.php
877 /vendor/prestashop/decimal/src/DecimalNumber.php
878 /vendor/prestashop/decimal/src/Builder.php
879 /src/Core/Product/Search/FacetCollection.php
880 /classes/ProductAssembler.php
881 /classes/tax/Tax.php
882 /classes/SpecificPrice.php
883 /classes/tax/TaxManagerFactory.php
884 /classes/tax/TaxRulesTaxManager.php
885 /classes/tax/TaxManagerInterface.php
886 /classes/tax/TaxCalculator.php
887 /classes/GroupReduction.php
888 /src/Core/Localization/CLDR/ComputingPrecision.php
889 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
890 /classes/Pack.php
891 /classes/order/Order.php
892 /classes/Feature.php
893 /classes/ProductPresenterFactory.php
894 /src/Adapter/Presenter/Product/ProductListingPresenter.php
895 /src/Adapter/Presenter/Product/ProductPresenter.php
896 /src/Adapter/Product/ProductColorsRetriever.php
897 /src/Adapter/HookManager.php
898 /src/Core/Product/ProductPresentationSettings.php
899 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
900 /src/Adapter/Presenter/Product/ProductLazyArray.php
901 /classes/Image.php
902 /src/Core/Image/ImageFormatConfiguration.php
903 /src/Core/Image/ImageFormatConfigurationInterface.php
904 /classes/FeatureFlag.php
905 /src/Core/FeatureFlag/FeatureFlagSettings.php
906 /classes/ImageManager.php
907 /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
908 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
909 /vendor/smarty/smarty/libs/plugins/modifier.count.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
912 /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
913 /src/Core/Product/Search/Pagination.php
914 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/a2/ac/10a2acb40a62faa7d4acf2ff79326cb9143364b9_2.file.category.tpl.php
915 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
916 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/7b/44/3b7b442e5be09f725564779ed89a7b73454120cc_2.file.product-list.tpl.php
917 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7b/05/e6/7b05e63eca4eeeca1407af0182fcc5f72eca6296_2.file.layout-left-column.tpl.php
918 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/dd/6f/fedd6f2f1c5383ca8f7a88001e645ec51798686f_2.file.layout-both-columns.tpl.php
919 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9f/7e/4a/9f7e4a2a31953c1ffd9af92c83bd91c1f3cd2c35_2.file.helpers.tpl.php
920 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
921 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/44/bf/b0/44bfb034c1f795379c422b7f1f9e16fbdd438c93_2.file.head.tpl.php
922 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/74/6f/a3/746fa3dd2b21e5f8274bb1f50aedff4595bb552e_2.file.head-jsonld.tpl.php
923 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/8d/80/d08d80bb870efd73dd55124817cbf5d770e7f7b2_2.file.product-list-jsonld.tpl.php
924 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/56/86/bf/5686bf9c07020fd395790a361d8976132a2fc4be_2.file.pagination-seo.tpl.php
925 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
926 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
927 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/93/e8/ed/93e8edeadb416f4f6abcf2d2b76fb0f54d0eba3d_2.file.stylesheets.tpl.php
928 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/af/76/c2af76b01726147ed1ded7543d0fd920339756bf_2.file.javascript.tpl.php
929 /classes/ProductDownload.php
930 /src/Core/Cart/Calculator.php
931 /src/Core/Cart/CartRowCollection.php
932 /src/Core/Cart/Fees.php
933 /src/Core/Cart/AmountImmutable.php
934 /src/Core/Cart/CartRuleCollection.php
935 /src/Core/Cart/CartRuleCalculator.php
936 /src/Adapter/Product/PriceCalculator.php
937 /src/Core/Cart/CartRow.php
938 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
939 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/0d/00/3b0d00bced40dc74d264c896b3629516dca0a06b_2.file.product-activation.tpl.php
940 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/2a/1d/d02a1d5aa2fc8a2b372e76425c1d49b597137881_2.file.header.tpl.php
941 /modules/iqitlinksmanager/iqitlinksmanager.php
942 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
943 /modules/iqitlinksmanager/src/IqitLinkBlock.php
944 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
945 /modules/iqitlinksmanager/translations/es.php
946 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
947 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
948 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
949 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
950 /modules/ps_languageselector/ps_languageselector.php
951 /modules/ps_currencyselector/ps_currencyselector.php
952 /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
953 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/54/66/f65466132945e631eb8304d318e35f83d75d651e_2.file.header-2.tpl.php
954 /modules/iqitsearch/iqitsearch.php
955 /modules/iqitsearch/translations/es.php
956 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
957 /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
958 /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
959 /modules/ps_customersignin/ps_customersignin.php
960 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
961 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
962 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
963 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
964 /var/cache/dev/smarty/compile/warehouse/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
965 /var/cache/dev/smarty/compile/warehouse/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
966 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/a0/a9/c9/a0a9c936f74308bdc1809002e948b8c26b0f5101.iqitmegamenuviewstemplateshookhorizontal.tpl.php
967 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/32/0c/d5/320cd56ae00cdb0df3cfaafda14dd79eef879159_2.file.mobile-header-2.tpl.php
968 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
969 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
970 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
971 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/88/01/f3/8801f3aef6612da9973e6f09844670ad2455b33c_2.file.breadcrumb.tpl.php
972 /modules/iqitproductsnav/iqitproductsnav.php
973 /modules/iqitproductsnav/translations/es.php
974 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/50/cf/2150cf9c7d24917c3322283d8d2a9798a55f33e1_2.file.notifications.tpl.php
975 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/39/dd/35/39dd3579b0d411714a13183f74f90657d9b16218_2.file.category-header.tpl.php
976 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/dc/dd/42/dcdd424ea5bdc2c731edea74e82e1b9752018d7f_2.file.products-top.tpl.php
977 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
978 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/f8/f7/e0f8f73bf2628e2a1784900d2234f9911a72566f_2.file.sort-orders.tpl.php
979 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/01/2d/6a/012d6af2272aef31c4959b70cb660dbba790eea4_2.file.pagination.tpl.php
980 /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
981 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e1/47/0e/e1470e491391572ac54700f0cafe332fed74977f_2.file.products.tpl.php
982 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/df/f3/21dff30aa3f82bc080b677e35ebedc1ec9a53690_2.file.product.tpl.php
983 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b2/b6/ab/b2b6ab658128da2281b45debedef04ba4285e0d8_2.file.product-miniature-1.tpl.php
984 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/70/ad/8b/70ad8bf895d617e9f5f73f4ce8c2c56d5c17c215_2.file.product-miniature-thumb.tpl.php
985 /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
986 /var/cache/dev/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
987 /modules/iqitproductflags/iqitproductflags.php
988 /src/Adapter/ContainerFinder.php
989 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php
990 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php
991 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php
992 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php
993 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php
994 /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php
995 /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php
996 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php
997 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php
998 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php
999 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php
1000 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php
1001 /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php
1002 /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php
1003 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php
1004 /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php
1005 /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php
1006 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php
1007 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php
1008 /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php
1009 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php
1010 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php
1011 /vendor/doctrine/persistence/src/Persistence/ObjectManager.php
1012 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php
1013 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php
1014 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php
1015 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php
1016 /vendor/doctrine/doctrine-bundle/ConnectionFactory.php
1017 /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php
1018 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php
1019 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php
1020 /vendor/doctrine/event-manager/src/EventManager.php
1021 /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php
1022 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php
1023 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php
1024 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php
1025 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php
1026 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php
1027 /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php
1028 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php
1029 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php
1030 /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php
1031 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php
1032 /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php
1033 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php
1034 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php
1035 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php
1036 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php
1037 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php
1038 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php
1039 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php
1040 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php
1041 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php
1042 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php
1043 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php
1044 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php
1045 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL80Platform.php
1046 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL57Platform.php
1047 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php
1048 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php
1049 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php
1050 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php
1051 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php
1052 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php
1053 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php
1054 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php
1055 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php
1056 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php
1057 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php
1058 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php
1059 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php
1060 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php
1061 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php
1062 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php
1063 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php
1064 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php
1065 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php
1066 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php
1067 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php
1068 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php
1069 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php
1070 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php
1071 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php
1072 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php
1073 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php
1074 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php
1075 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php
1076 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php
1077 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php
1078 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php
1079 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php
1080 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php
1081 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php
1082 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php
1083 /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php
1084 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php
1085 /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php
1086 /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php
1087 /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php
1088 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php
1089 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php
1090 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php
1091 /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php
1092 /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php
1093 /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php
1094 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php
1095 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php
1096 /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php
1097 /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php
1098 /vendor/doctrine/persistence/src/Persistence/Proxy.php
1099 /modules/iqitproductflags/src/Entity/IqitProductFlag.php
1100 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php
1101 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php
1102 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php
1103 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php
1104 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php
1105 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php
1106 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php
1107 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php
1108 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php
1109 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php
1110 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php
1111 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php
1112 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php
1113 /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php
1114 /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php
1115 /src/PrestaShopBundle/Entity/Shop.php
1116 /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php
1117 /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php
1118 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php
1119 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php
1120 /modules/iqitproductflags/src/Repository/FlagRepository.php
1121 /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php
1122 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php
1123 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php
1124 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php
1125 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php
1126 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php
1127 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php
1128 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php
1129 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php
1130 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php
1131 /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php
1132 /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php
1133 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php
1134 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php
1135 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php
1136 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php
1137 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php
1138 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php
1139 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php
1140 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php
1141 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php
1142 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php
1143 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php
1144 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php
1145 /src/PrestaShopBundle/Entity/Lang.php
1146 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php
1147 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php
1148 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php
1149 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php
1150 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php
1151 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php
1152 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php
1153 /src/PrestaShopBundle/Entity/ShopGroup.php
1154 /src/PrestaShopBundle/Entity/ShopUrl.php
1155 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php
1156 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php
1157 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php
1158 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php
1159 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php
1160 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php
1161 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php
1162 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php
1163 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php
1164 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php
1165 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php
1166 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php
1167 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php
1168 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php
1169 /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php
1170 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php
1171 /src/PrestaShopBundle/Entity/Translation.php
1172 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php
1173 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php
1174 /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php
1175 /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php
1176 /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php
1177 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php
1178 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php
1179 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php
1180 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php
1181 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php
1182 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php
1183 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php
1184 /modules/iqitproductflags/src/Presenter/FlagPresenter.php
1185 /var/cache/dev/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php
1186 /var/cache/dev/smarty/compile/warehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1187 /vendor/smarty/smarty/libs/plugins/function.math.php
1188 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/75/b9/97/75b997bec85704ff1d7a8fb47417253a50e7be32_2.file.product-miniature-btn.tpl.php
1189 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/50/d2/88/50d288732d70e59ef94f3875a561157d73c09f9e_2.file.products-bottom.tpl.php
1190 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/ce/84/ea/ce84eadc655e6b98707bc940129b94e0b7569370_2.file.category-footer.tpl.php
1191 /modules/ps_categorytree/ps_categorytree.php
1192 /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1193 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/3a/47/3e3a47dc2c5a5d8e5e109d269aa58f1349bf3548_2.file.footer.tpl.php
1194 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e6/9f/81/e69f8156b2319dff0e9edb2994d7f3cbefe774c5_2.file.footer-2.tpl.php
1195 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1196 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/6/warehouse/1d/83/01/1d8301bd7699d773c48e9ed487e5b638a51c9c67.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1197 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/00/82/b5/0082b5f5ed9b849deb993e6b9ea0688ca3375d26_2.file.footer-copyrights-1.tpl.php
1198 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e7/73/6b/e7736b26e5e94f428f828dbc3573ce171a95c436_2.file.password-policy-template.tpl.php
1199 /classes/form/CustomerLoginForm.php
1200 /classes/form/AbstractForm.php
1201 /classes/form/FormInterface.php
1202 /src/Core/Foundation/Templating/RenderableInterface.php
1203 /classes/form/CustomerLoginFormatter.php
1204 /classes/form/FormFormatterInterface.php
1205 /classes/ValidateConstraintTranslator.php
1206 /src/Core/Util/InternationalizedDomainNameConverter.php
1207 /src/Core/Foundation/Templating/RenderableProxy.php
1208 /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1209 /classes/form/FormField.php
1210 /var/cache/dev/smarty/compile/warehouse/f2/1e/55/f21e55894ac1dca3333e5ff490219e193d3a69c6_2.file.login-form.tpl.php
1211 /var/cache/dev/smarty/compile/warehouse/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1212 /var/cache/dev/smarty/compile/d2/95/88/d29588162f18c1514f5b17d42ceef7eee6820be1_2.file.form-fields.tpl.php
1213 /var/cache/dev/smarty/compile/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1214 /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/6/warehouse/60/1e/f4/601ef4a2f7dca2c97f8f1a899dc64be4a2331ab8.iqitsocialloginviewstemplateshookauthentication.tpl.php
1215 /var/cache/dev/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1216 /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/02/05/98/020598f14f8b3a756a608f01492a41ebd60e5afd.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1217 /modules/statsdata/statsdata.php
1218 /classes/Connection.php
1219 /classes/ConnectionsSource.php
1220 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1221 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1222 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1223 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1224 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1225 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1226 /var/cache/dev/smarty/compile/warehouse/0b/04/d5/0b04d5d296cc40e94fc50a82355434090632a0d7_2.file.ga_tag.tpl.php