FACIAL

Cosmética facial 

Cuida tu piel con nuestra dermocosmética facial

Mostrando 1-47 de 47 artículo(s)
Producto añadido
Producto añadido a Comparar

Este sitio web utiliza cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Para dar su consentimiento sobre su uso pulse el botón Acepto.

Load Time 888 ms
Querying Time 425 ms
Queries 895
Memory Peak Usage 68.6 Mb
Included Files 1226 files - 12.70 Mb
PrestaShop Cache - Mb
Global vars 0.05 Mb
PrestaShop Version 8.2.7
PHP Version 8.4.10
MySQL Version 8.0.45-36
Memory Limit 512M
Max Execution Time 165s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 98.906 ms 98.906 ms 18.40 Mb 19.6 Mb
__construct 0.015 ms 98.921 ms - Mb 19.6 Mb
init 32.514 ms 131.435 ms 5.29 Mb 24.7 Mb
checkAccess 0.001 ms 131.436 ms - Mb 24.7 Mb
setMedia 3.721 ms 135.157 ms 0.79 Mb 24.7 Mb
postProcess 0.001 ms 135.158 ms - Mb 24.7 Mb
initHeader 0.002 ms 135.160 ms - Mb 24.7 Mb
initContent 448.090 ms 583.250 ms 25.93 Mb 50.5 Mb
initFooter 0.002 ms 583.252 ms - Mb 50.5 Mb
display 304.385 ms 888 ms 16.83 Mb 68.6 Mb
Hook Time Memory Usage
DisplayProductCampagains 122.865 ms 7.02 Mb
displayProductListReviews 32.961 ms 1.79 Mb
displayProductListFunctionalButtons 19.317 ms 0.12 Mb
DisplayBeforeBodyClosingTag 9.447 ms 0.34 Mb
displayBeforeBodyClosingTag 6.595 ms 0.81 Mb
displayLeftColumn 5.993 ms 0.23 Mb
displayNav2 3.559 ms 0.17 Mb
displayNav1 2.380 ms 0.21 Mb
DisplayHeader 2.326 ms 0.18 Mb
renderWidget 2.210 ms 0.20 Mb
displayFooter 1.823 ms 0.10 Mb
displayCategoryElementor 1.746 ms 0.08 Mb
displayMainMenu 1.298 ms 0.20 Mb
displayCustomerLoginFormAfter 1.235 ms 0.07 Mb
displayTop 1.174 ms 0.12 Mb
ProductSearchProvider 1.155 ms 0.20 Mb
displayAfterBreadcrumb 0.888 ms 0.04 Mb
ActionFrontControllerSetMedia 0.693 ms 0.13 Mb
IsJustElementor 0.518 ms 0.02 Mb
DisplayLeftColumn 0.428 ms 0.08 Mb
OverrideLayoutTemplate 0.039 ms - Mb
ModuleRoutes 0.010 ms - Mb
ActionProductSearchAfter 0.007 ms - Mb
displayVerticalMenu 0.007 ms - Mb
ActionDispatcher 0.005 ms - Mb
25 hook(s) 218.680 ms 12.11 Mb
Module Time Memory Usage
ph_simpleblog 11.830 ms 3.30 Mb
iqitthemeeditor 1.862 ms 0.54 Mb
ps_emailsubscription 1.790 ms 0.37 Mb
ps_emailalerts 1.225 ms 0.29 Mb
iqitproductvariants 0.325 ms 0.04 Mb
revsliderprestashop 30.037 ms 7.98 Mb
productcomments 0.863 ms 0.28 Mb
ps_shoppingcart 1.419 ms 0.17 Mb
iqitcontactpage 1.893 ms 0.12 Mb
iqitcookielaw 1.668 ms 0.11 Mb
iqitcountdown 0.193 ms 0.03 Mb
iqitsociallogin 1.564 ms 0.14 Mb
ps_googleanalytics 6.322 ms 0.38 Mb
iqitsizecharts 0.874 ms 0.26 Mb
iqitwishlist 16.701 ms 0.96 Mb
iqitreviews 33.491 ms 1.91 Mb
iqitpopup 1.301 ms 0.15 Mb
iqitmegamenu 4.491 ms 1.06 Mb
iqitcompare 10.161 ms 0.18 Mb
iqitelementor 5.945 ms 1.07 Mb
iqitextendedproduct 0.671 ms 0.16 Mb
iqitfreedeliverycount 0.315 ms 0.06 Mb
ps_facetedsearch 4.866 ms 0.91 Mb
iqitlinksmanager 3.847 ms 0.38 Mb
ps_languageselector 0.959 ms 0.07 Mb
ps_currencyselector 0.959 ms 0.07 Mb
iqitsearch 2.125 ms 0.12 Mb
ps_customersignin 0.176 ms 0.03 Mb
iqitproductsnav 1.624 ms 0.07 Mb
iqitproductflags 123.485 ms 7.15 Mb
ps_categorytree 6.376 ms 0.36 Mb
statsdata 4.473 ms 0.16 Mb
32 module(s) 283.831 ms 28.89 Mb

Stopwatch SQL - 895 queries

# Query Time (ms) Rows Filesort Group By Location
83
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p GROUP BY p.id_manufacturer
17.651 ms 39950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
784
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
12.852 ms 1 Yes Yes /classes/Product.php:4513
677
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2349) AND (b.`id_shop` = 1) LIMIT 1
5.020 ms 1 /src/Adapter/EntityMapper.php:71
91
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 6) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-06-22 19:51:59' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-06-22 19:51:59' <= sp.to) 
) WHERE ((sp.reduction>0))
3.385 ms 208 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
93
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-06-22 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM och438product p
LEFT JOIN och438product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN och438stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN och438product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1717,698,2429,2427,2428,745,753,2433,757,766,767,768,769,2662,1164,1378,1471,2521,1510,1469,1350,1482,1421,1622,1373,1477,1424,1285,1718,1719,1795,1866,1867,2033,2052,2051,2316,2319,2349,2405,2406,2447,2465,2502,2542,2554,2678)
3.332 ms 47 /classes/ProductAssembler.php:95
89
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE ((p.on_sale=1))
3.190 ms 208 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
90
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE p.date_add>'2026-06-03 00:00:00'
3.075 ms 208 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
108
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `och438hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `och438hook_alias` ha
INNER JOIN `och438hook` h ON ha.name = h.name
2.992 ms 0 /classes/Hook.php:1348
892
INSERT INTO `och438connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('198371', '', 'farmacialanueva.online/22-facial?q=Marca-BIOCOSMETICS-MIIN+COSMETICS+S.L.-VT+COSMETICS-SKINCEUTICALS&resultsPerPage=99999', '', '2026-06-22 19:51:59')
2.908 ms 1 /classes/ObjectModel.php:622
109
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `och438hook_module` hm
STRAIGHT_JOIN `och438hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `och438module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.881 ms 524 /classes/Hook.php:455
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `och438configuration` c
LEFT JOIN `och438configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
2.569 ms 1327 /classes/Configuration.php:180
84
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM och438product p INNER JOIN och438layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 6) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40
2.382 ms 104 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
894
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `och438category_product` cp
LEFT JOIN `och438category` c ON (c.id_category = cp.id_category)
LEFT JOIN `och438category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (1717,698,2429,2427,2428,745,753,2433,757,766,767,768,769,2662,1164,1378,1471,2521,1510,1469,1350,1482,1421,1622,1373,1477,1424,1285,1718,1719,1795,1866,1867,2033,2052,2051,2316,2319,2349,2405,2406,2447,2465,2502,2542,2554,2678) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
2.218 ms 2745 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:103
92
REPLACE INTO och438layered_filter_block (hash, data) VALUES ("7bfa9bc0ebf32408487961135cd19e03", "a:1:{s:7:\"filters\";a:4:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:10:{i:26;a:2:{s:4:\"name\";s:11:\"LIMPIADORES\";s:3:\"nbr\";s:1:\"4\";}i:29;a:2:{s:4:\"name\";s:5:\"SERUM\";s:3:\"nbr\";s:2:\"15\";}i:33;a:2:{s:4:\"name\";s:16:\"CONTORNO DE OJOS\";s:3:\"nbr\";s:1:\"2\";}i:41;a:2:{s:4:\"name\";s:11:\"MASCARILLAS\";s:3:\"nbr\";s:1:\"5\";}i:42;a:2:{s:4:\"name\";s:8:\"TÓNICOS\";s:3:\"nbr\";s:1:\"2\";}i:44;a:2:{s:4:\"name\";s:6:\"CREMAS\";s:3:\"nbr\";s:1:\"7\";}i:45;a:2:{s:4:\"name\";s:8:\"ESENCIAS\";s:3:\"nbr\";s:1:\"2\";}i:130;a:2:{s:4:\"name\";s:17:\"COSMETICA COREANA\";s:3:\"nbr\";s:2:\"13\";}i:131;a:2:{s:4:\"name\";s:16:\"POTENCIA TU GLOW\";s:3:\"nbr\";s:1:\"7\";}i:138;a:2:{s:4:\"name\";s:7:\"MANCHAS\";s:3:\"nbr\";s:1:\"3\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:38:{i:3;a:2:{s:4:\"name\";s:5:\"ISDIN\";s:3:\"nbr\";s:1:\"8\";}i:5;a:2:{s:4:\"name\";s:14:\"Cantabria Labs\";s:3:\"nbr\";s:1:\"1\";}i:6;a:2:{s:4:\"name\";s:6:\"Cerave\";s:3:\"nbr\";s:2:\"22\";}i:7;a:2:{s:4:\"name\";s:3:\"SVR\";s:3:\"nbr\";s:1:\"1\";}i:11;a:2:{s:4:\"name\";s:14:\"LA ROCHE POSAY\";s:3:\"nbr\";s:2:\"19\";}i:12;a:2:{s:4:\"name\";s:11:\"IFCANTABRIA\";s:3:\"nbr\";s:2:\"54\";}i:13;a:2:{s:4:\"name\";s:15:\"LAB SVR ESPAÑA\";s:3:\"nbr\";s:2:\"68\";}i:14;a:3:{s:4:\"name\";s:13:\"SKINCEUTICALS\";s:3:\"nbr\";s:2:\"32\";s:7:\"checked\";b:1;}i:22;a:2:{s:4:\"name\";s:18:\"LETI PHARMA S.L.U.\";s:3:\"nbr\";s:1:\"3\";}i:57;a:2:{s:4:\"name\";s:11:\"ARTURO ALBA\";s:3:\"nbr\";s:2:\"23\";}i:58;a:2:{s:4:\"name\";s:8:\"ERBORIAN\";s:3:\"nbr\";s:2:\"20\";}i:59;a:2:{s:4:\"name\";s:13:\"Moncho moreno\";s:3:\"nbr\";s:1:\"1\";}i:61;a:2:{s:4:\"name\";s:3:\"TWO\";s:3:\"nbr\";s:2:\"20\";}i:62;a:2:{s:4:\"name\";s:15:\"IVB Welness lab\";s:3:\"nbr\";s:1:\"1\";}i:67;a:2:{s:4:\"name\";s:22:\"L´occitane (erborian)\";s:3:\"nbr\";s:2:\"58\";}i:68;a:2:{s:4:\"name\";s:18:\"GEMA HERRERIA S.LU\";s:3:\"nbr\";s:2:\"33\";}i:70;a:3:{s:4:\"name\";s:19:\"MIIN COSMETICS S.L.\";s:3:\"nbr\";s:2:\"11\";s:7:\"checked\";b:1;}i:87;a:2:{s:4:\"name\";s:7:\"OZOAQUA\";s:3:\"nbr\";s:1:\"1\";}i:93;a:2:{s:4:\"name\";s:16:\"BEAUTY OF JOSEON\";s:3:\"nbr\";s:2:\"24\";}i:94;a:2:{s:4:\"name\";s:6:\"TOCOBO\";s:3:\"nbr\";s:1:\"9\";}i:99;a:2:{s:4:\"name\";s:6:\"BIODES\";s:3:\"nbr\";s:1:\"5\";}i:100;a:2:{s:4:\"name\";s:12:\"CANTABRIA PH\";s:3:\"nbr\";s:1:\"3\";}i:112;a:2:{s:4:\"name\";s:6:\"d\'Alba\";s:3:\"nbr\";s:1:\"6\";}i:113;a:2:{s:4:\"name\";s:15:\"haruharu wonder\";s:3:\"nbr\";s:1:\"2\";}i:114;a:2:{s:4:\"name\";s:8:\"Dr.Jart+\";s:3:\"nbr\";s:1:\"3\";}i:115;a:2:{s:4:\"name\";s:8:\"MEDICUBE\";s:3:\"nbr\";s:2:\"23\";}i:116;a:2:{s:4:\"name\";s:32:\"ESPAÑOLA DE NUEVOS TRATAMIENTOS\";s:3:\"nbr\";s:1:\"6\";}i:117;a:2:{s:4:\"name\";s:6:\"MISSHA\";s:3:\"nbr\";s:1:\"5\";}i:119;a:2:{s:4:\"name\";s:6:\"TIRTIR\";s:3:\"nbr\";s:1:\"6\";}i:120;a:2:{s:4:\"name\";s:10:\"Dr. Althea\";s:3:\"nbr\";s:1:\"1\";}i:121;a:2:{s:4:\"name\";s:13:\"UNICSKIN S.L.\";s:3:\"nbr\";s:1:\"2\";}i:122;a:2:{s:4:\"name\";s:19:\"ALTA COMESTICA S.L.\";s:3:\"nbr\";s:1:\"1\";}i:123;a:2:{s:4:\"name\";s:4:\"FIMO\";s:3:\"nbr\";s:1:\"1\";}i:124;a:2:{s:4:\"name\";s:42:\"ASOCIACION ESPAÑOLA DE PKAN ISBEL HEREDIA\";s:3:\"nbr\";s:1:\"1\";}i:125;a:2:{s:4:\"name\";s:4:\"ANUA\";s:3:\"nbr\";s:1:\"4\";}i:126;a:3:{s:4:\"name\";s:12:\"VT COSMETICS\";s:3:\"nbr\";s:1:\"3\";s:7:\"checked\";b:1;}i:127;a:3:{s:4:\"name\";s:12:\"BIOCOSMETICS\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:128;a:2:{s:4:\"name\";s:8:\"ASIN FCA\";s:3:\"nbr\";s:1:\"2\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:289;s:3:\"min\";d:3;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:47;s:5:\"value\";N;}i:3;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Selecciones\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:9:\"En oferta\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:5:\"Nuevo\";s:3:\"nbr\";i:2;}s:8:\"discount\";a:2:{s:4:\"name\";s:13:\"Con descuento\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
2.148 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:210
88
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute
1.804 ms 208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
72
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
1.597 ms 416 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
75
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=3 AND c.nleft>7 AND c.nright<40 GROUP BY cp.id_category
1.551 ms 416 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
787
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1510) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.473 ms 1 Yes Yes /classes/Product.php:4513
86
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute
1.397 ms 208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
877
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `och438category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `och438category` c2 ON c2.`id_category` = 22 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 6 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
1.384 ms 61 Yes Yes /classes/Category.php:785
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `och438module` m
INNER JOIN och438module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `och438hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `och438hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `och438module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.243 ms 1560 Yes Yes /classes/Hook.php:1289
790
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1469) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.163 ms 1 Yes Yes /classes/Product.php:4513
85
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC
1.128 ms 3 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
785
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1510
1.059 ms 2 /classes/Product.php:3420
157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2428 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.049 ms 1 Yes /classes/SpecificPrice.php:576
124
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 698)
1.045 ms 1 /classes/Product.php:3860
87
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC
1.038 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
117
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1717 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1717 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.010 ms 0 /classes/Cart.php:1430
763
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (767) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.999 ms 1 Yes Yes /classes/Product.php:4513
258
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1164 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1164 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.973 ms 0 /classes/Cart.php:1430
181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 753 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 753 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.962 ms 0 /classes/Cart.php:1430
754
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2433) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.944 ms 1 Yes Yes /classes/Product.php:4513
757
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (757) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.938 ms 1 Yes Yes /classes/Product.php:4513
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `och438hook` h
WHERE (h.active = 1)
0.927 ms 1143 /classes/Hook.php:1388
760
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (766) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.913 ms 1 Yes Yes /classes/Product.php:4513
452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2051
AND image_shop.`cover` = 1 LIMIT 1
0.897 ms 1 /classes/Product.php:3570
786
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1510 LIMIT 1
0.897 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2427 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.873 ms 1 Yes /classes/SpecificPrice.php:576
202
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 757 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 757 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.869 ms 0 /classes/Cart.php:1430
188
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2433 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.858 ms 1 Yes /classes/SpecificPrice.php:576
135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2429 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.850 ms 1 Yes /classes/SpecificPrice.php:576
468
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2316 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2316 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.847 ms 0 /classes/Cart.php:1430
128
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 698 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 698 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.845 ms 0 /classes/Cart.php:1430
105
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1717 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.837 ms 1 Yes /classes/SpecificPrice.php:576
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2429 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2429 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.831 ms 0 /classes/Cart.php:1430
766
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (768) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.825 ms 1 Yes Yes /classes/Product.php:4513
193
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2433 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2433 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.824 ms 0 /classes/Cart.php:1430
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook`
0.822 ms 1143 /classes/Hook.php:1348
249
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2662 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2662 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.822 ms 0 /classes/Cart.php:1430
239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 769 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 769 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.820 ms 0 /classes/Cart.php:1430
221
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 767 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 767 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.819 ms 0 /classes/Cart.php:1430
230
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 768 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 768 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.815 ms 0 /classes/Cart.php:1430
151
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2427 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2427 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.811 ms 0 /classes/Cart.php:1430
868
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2554) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.811 ms 1 Yes Yes /classes/Product.php:4513
871
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2678) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.811 ms 1 Yes Yes /classes/Product.php:4513
211
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 766 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 766 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.795 ms 0 /classes/Cart.php:1430
110
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.760 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:100
791
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1350
0.750 ms 1 /classes/Product.php:3420
215
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 767) AND (b.`id_shop` = 1) LIMIT 1
0.749 ms 1 /src/Adapter/EntityMapper.php:71
81
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value
0.731 ms 208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
172
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 745 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 745 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.727 ms 0 /classes/Cart.php:1430
119
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 698
AND image_shop.`cover` = 1 LIMIT 1
0.720 ms 1 /classes/Product.php:3570
254
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1164)
0.718 ms 1 /classes/Product.php:3860
756
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 757 LIMIT 1
0.699 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
257
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1164) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.686 ms 1 /classes/stock/StockAvailable.php:453
213
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 767
AND image_shop.`cover` = 1 LIMIT 1
0.684 ms 1 /classes/Product.php:3570
69
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.676 ms 129 Yes /classes/Manufacturer.php:201
82
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.671 ms 129 Yes /classes/Manufacturer.php:201
162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2428 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2428 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.670 ms 0 /classes/Cart.php:1430
759
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 766 LIMIT 1
0.669 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
210
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.667 ms 1 /classes/stock/StockAvailable.php:453
118
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1717
ORDER BY f.position ASC
0.666 ms 1 Yes /classes/Product.php:6024
761
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 767
0.661 ms 2 /classes/Product.php:3420
77
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute
0.660 ms 208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
866
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2554
0.656 ms 4 /classes/Product.php:3420
762
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 767 LIMIT 1
0.650 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
764
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 768
0.647 ms 2 /classes/Product.php:3420
79
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute
0.646 ms 208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
37
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `och438category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 22
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.646 ms 61 Yes Yes /classes/Category.php:916
789
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1469 LIMIT 1
0.644 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
758
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 766
0.638 ms 2 /classes/Product.php:3420
883
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.631 ms 1 /classes/module/Module.php:2664
580
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2428) AND (b.`id_shop` = 1) LIMIT 1
0.626 ms 1 /src/Adapter/EntityMapper.php:71
750
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 753 LIMIT 1
0.625 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
755
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 757
0.616 ms 3 /classes/Product.php:3420
101
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `och438specific_price` WHERE `id_product` != 0
0.616 ms 521 /classes/SpecificPrice.php:310
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2429
ORDER BY f.position ASC
0.610 ms 1 Yes /classes/Product.php:6024
152
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2427
ORDER BY f.position ASC
0.610 ms 1 Yes /classes/Product.php:6024
250
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2662
ORDER BY f.position ASC
0.608 ms 1 Yes /classes/Product.php:6024
222
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 767
ORDER BY f.position ASC
0.607 ms 1 Yes /classes/Product.php:6024
80
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 70, 14, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value
0.604 ms 208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
608
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1164) AND (b.`id_shop` = 1) LIMIT 1
0.604 ms 1 /src/Adapter/EntityMapper.php:71
459
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2051 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2051 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.603 ms 0 /classes/Cart.php:1430
846
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2349 LIMIT 1
0.602 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
882
SELECT SQL_NO_CACHE c.*, cl.*  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 121 ORDER BY `nleft` DESC
0.598 ms 4 /classes/Category.php:1594
259
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1164
ORDER BY f.position ASC
0.597 ms 1 Yes /classes/Product.php:6024
884
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.595 ms 1 /classes/module/Module.php:2137
182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 753
ORDER BY f.position ASC
0.594 ms 1 Yes /classes/Product.php:6024
599
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 768) AND (b.`id_shop` = 1) LIMIT 1
0.592 ms 1 /src/Adapter/EntityMapper.php:71
194
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2433
ORDER BY f.position ASC
0.591 ms 1 Yes /classes/Product.php:6024
153
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2428
AND image_shop.`cover` = 1 LIMIT 1
0.586 ms 1 /classes/Product.php:3570
870
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2678 LIMIT 1
0.586 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
765
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 768 LIMIT 1
0.585 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
129
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 698
ORDER BY f.position ASC
0.584 ms 1 Yes /classes/Product.php:6024
878
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.583 ms 1 /classes/Category.php:2239
158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2428)
0.581 ms 1 /classes/Product.php:3860
263
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1378)
0.581 ms 1 /classes/Product.php:3860
879
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.579 ms 1 /src/Adapter/EntityMapper.php:71
212
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 766
ORDER BY f.position ASC
0.578 ms 1 Yes /classes/Product.php:6024
240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 769
ORDER BY f.position ASC
0.575 ms 1 Yes /classes/Product.php:6024
78
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC
0.571 ms 14 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2428
ORDER BY f.position ASC
0.570 ms 1 Yes /classes/Product.php:6024
867
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2554 LIMIT 1
0.570 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
823
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1795) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.569 ms 1 Yes Yes /classes/Product.php:4513
76
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC
0.568 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
389
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1718 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.567 ms 1 Yes /classes/SpecificPrice.php:576
198
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 757)
0.562 ms 1 /classes/Product.php:3860
203
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 757
ORDER BY f.position ASC
0.562 ms 1 Yes /classes/Product.php:6024
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2429)
0.559 ms 1 /classes/Product.php:3860
283
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.557 ms 1 Yes /classes/SpecificPrice.php:576
653
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1795) AND (b.`id_shop` = 1) LIMIT 1
0.557 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 745) AND (b.`id_shop` = 1) LIMIT 1
0.555 ms 1 /src/Adapter/EntityMapper.php:71
245
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2662)
0.555 ms 1 /classes/Product.php:3860
774
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1164 LIMIT 1
0.550 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
173
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 745
ORDER BY f.position ASC
0.548 ms 1 Yes /classes/Product.php:6024
528
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.547 ms 1 /classes/Product.php:5670
847
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2349) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.547 ms 1 Yes Yes /classes/Product.php:4513
717
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 69 AND `id_shop` = 1 LIMIT 1
0.544 ms 1 /classes/module/Module.php:2137
231
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 768
ORDER BY f.position ASC
0.542 ms 1 Yes /classes/Product.php:6024
235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 769)
0.541 ms 1 /classes/Product.php:3860
700
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2678) AND (b.`id_shop` = 1) LIMIT 1
0.540 ms 1 /src/Adapter/EntityMapper.php:71
662
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2033) AND (b.`id_shop` = 1) LIMIT 1
0.538 ms 1 /src/Adapter/EntityMapper.php:71
869
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2678
0.538 ms 2 /classes/Product.php:3420
102
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `from` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.538 ms 1 /classes/SpecificPrice.php:377
876
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.538 ms 1 /classes/module/Module.php:2137
768
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 769 LIMIT 1
0.536 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
767
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 769
0.536 ms 2 /classes/Product.php:3420
100
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `id_product` != 0 LIMIT 1
0.530 ms 521 /classes/SpecificPrice.php:297
509
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2447
AND image_shop.`cover` = 1 LIMIT 1
0.530 ms 1 /classes/Product.php:3570
67
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `och438attribute_group` ag  INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `och438layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
0.528 ms 4 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122
378
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1285 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.527 ms 1 Yes /classes/SpecificPrice.php:576
189
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2433)
0.526 ms 1 /classes/Product.php:3860
891
SELECT SQL_NO_CACHE `id_guest`
FROM `och438connections`
WHERE `id_guest` = 198807
AND `date_add` > '2026-06-22 19:21:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.525 ms 1 Yes /classes/Connection.php:168
183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2433
AND image_shop.`cover` = 1 LIMIT 1
0.523 ms 1 /classes/Product.php:3570
130
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2429
AND image_shop.`cover` = 1 LIMIT 1
0.522 ms 1 /classes/Product.php:3570
207
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 766)
0.522 ms 1 /classes/Product.php:3860
115
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.521 ms 0 /classes/tax/TaxRulesTaxManager.php:100
195
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 757
AND image_shop.`cover` = 1 LIMIT 1
0.516 ms 1 /classes/Product.php:3570
74
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.514 ms 61 Yes /classes/Category.php:710
261
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.514 ms 1 /classes/Product.php:5670
265
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1378 AND `id_group` = 1 LIMIT 1
0.514 ms 0 /classes/GroupReduction.php:153
400
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1719 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.514 ms 1 Yes /classes/SpecificPrice.php:576
545
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.511 ms 0 /classes/Cart.php:1430
874
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c LEFT JOIN och438iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 22 AND s.id_shop = 1 LIMIT 1
0.509 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2427
AND image_shop.`cover` = 1 LIMIT 1
0.508 ms 1 /classes/Product.php:3570
251
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1164
AND image_shop.`cover` = 1 LIMIT 1
0.508 ms 1 /classes/Product.php:3570
383
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1285 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.507 ms 0 /classes/Cart.php:1430
116
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1717) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.505 ms 1 /classes/stock/StockAvailable.php:453
243
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 126
AND `active` = 1 LIMIT 1
0.505 ms 1 /classes/Manufacturer.php:312
354
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1373 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1373 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.505 ms 0 /classes/Cart.php:1430
234
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 769 LIMIT 1
0.504 ms 1 /classes/SpecificPrice.php:435
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `och438meta` m
LEFT JOIN `och438meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.501 ms 57 Yes /classes/Dispatcher.php:654
217
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 767)
0.501 ms 1 /classes/Product.php:3860
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.499 ms 104 /classes/module/Module.php:341
260
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1378
AND image_shop.`cover` = 1 LIMIT 1
0.499 ms 1 /classes/Product.php:3570
256
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1164 AND `id_group` = 1 LIMIT 1
0.497 ms 0 /classes/GroupReduction.php:153
873
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.497 ms 1 /classes/module/Module.php:2137
204
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 766
AND image_shop.`cover` = 1 LIMIT 1
0.496 ms 2 /classes/Product.php:3570
68
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `och438feature` f  INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `och438feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `och438layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.495 ms 6 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:159
223
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 768
AND image_shop.`cover` = 1 LIMIT 1
0.494 ms 2 /classes/Product.php:3570
788
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1469
0.494 ms 1 /classes/Product.php:3420
226
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 768)
0.492 ms 1 /classes/Product.php:3860
872
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitelementor" LIMIT 1
0.492 ms 1 /classes/module/Module.php:2664
885
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.491 ms 1 /classes/module/Module.php:2664
742
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2427) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.491 ms 1 Yes Yes /classes/Product.php:4513
644
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1285) AND (b.`id_shop` = 1) LIMIT 1
0.490 ms 1 /src/Adapter/EntityMapper.php:71
232
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 769
AND image_shop.`cover` = 1 LIMIT 1
0.488 ms 1 /classes/Product.php:3570
635
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1373) AND (b.`id_shop` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
363
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1477 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1477 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.487 ms 0 /classes/Cart.php:1430
54
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.485 ms 0 /classes/module/Module.php:2664
372
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1424 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1424 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.483 ms 0 /classes/Cart.php:1430
355
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1373
ORDER BY f.position ASC
0.482 ms 1 Yes /classes/Product.php:6024
169
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 745 AND id_shop=1 LIMIT 1
0.481 ms 1 /classes/Product.php:6884
483
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2349 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.481 ms 1 Yes /classes/SpecificPrice.php:576
704
SELECT SQL_NO_CACHE 1 FROM och438cart_product cp INNER JOIN och438product p
ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.480 ms 1 /classes/Cart.php:4250
98
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 0 LIMIT 1
0.479 ms 1 /classes/SpecificPrice.php:426
123
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 698 LIMIT 1
0.479 ms 1 /classes/SpecificPrice.php:435
174
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 753
AND image_shop.`cover` = 1 LIMIT 1
0.479 ms 2 /classes/Product.php:3570
248
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2662) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.479 ms 1 /classes/stock/StockAvailable.php:453
638
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1477) AND (b.`id_shop` = 1) LIMIT 1
0.479 ms 1 /src/Adapter/EntityMapper.php:71
133
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2429 LIMIT 1
0.478 ms 1 /classes/SpecificPrice.php:435
488
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2349 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2349 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.477 ms 0 /classes/Cart.php:1430
540
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.477 ms 1 Yes /classes/SpecificPrice.php:576
682
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2406) AND (b.`id_shop` = 1) LIMIT 1
0.476 ms 1 /src/Adapter/EntityMapper.php:71
127
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 698) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.476 ms 1 /classes/stock/StockAvailable.php:453
241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2662
AND image_shop.`cover` = 1 LIMIT 1
0.475 ms 1 /classes/Product.php:3570
229
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 768) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.475 ms 1 /classes/stock/StockAvailable.php:453
880
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 22 LIMIT 1
0.475 ms 1 /classes/Category.php:1584
656
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1866) AND (b.`id_shop` = 1) LIMIT 1
0.473 ms 1 /src/Adapter/EntityMapper.php:71
814
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1285) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.473 ms 1 Yes Yes /classes/Product.php:4513
267
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1378 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1378 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.472 ms 0 /classes/Cart.php:1430
106
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1717)
0.470 ms 1 /classes/Product.php:3860
186
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2433 LIMIT 1
0.470 ms 1 /classes/SpecificPrice.php:435
111
SELECT SQL_NO_CACHE *
FROM `och438tax` a
WHERE (a.`id_tax` = 31) LIMIT 1
0.470 ms 1 /src/Adapter/EntityMapper.php:71
659
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1867) AND (b.`id_shop` = 1) LIMIT 1
0.469 ms 1 /src/Adapter/EntityMapper.php:71
665
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2052) AND (b.`id_shop` = 1) LIMIT 1
0.468 ms 1 /src/Adapter/EntityMapper.php:71
875
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_categorytree" LIMIT 1
0.467 ms 1 /classes/module/Module.php:2664
641
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1424) AND (b.`id_shop` = 1) LIMIT 1
0.465 ms 1 /src/Adapter/EntityMapper.php:71
733
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1717) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.465 ms 1 Yes Yes /classes/Product.php:4513
150
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2427) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.464 ms 1 /classes/stock/StockAvailable.php:453
171
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 745) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.464 ms 1 /classes/stock/StockAvailable.php:453
224
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.464 ms 1 /classes/Product.php:5670
647
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1718) AND (b.`id_shop` = 1) LIMIT 1
0.464 ms 1 /src/Adapter/EntityMapper.php:71
266
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1378) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.462 ms 1 /classes/stock/StockAvailable.php:453
192
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2433) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.461 ms 1 /classes/stock/StockAvailable.php:453
201
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 757) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.461 ms 1 /classes/stock/StockAvailable.php:453
197
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 757 LIMIT 1
0.460 ms 1 /classes/SpecificPrice.php:435
252
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.459 ms 1 /classes/Product.php:5670
564
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2678 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2678 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.459 ms 0 /classes/Cart.php:1430
769
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (769) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4513
413
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1795) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.457 ms 1 /classes/stock/StockAvailable.php:453
94
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1717
AND image_shop.`cover` = 1 LIMIT 1
0.457 ms 1 /classes/Product.php:3570
748
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (745) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.456 ms 1 Yes Yes /classes/Product.php:4513
228
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 768 AND `id_group` = 1 LIMIT 1
0.454 ms 0 /classes/GroupReduction.php:153
781
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1471) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.454 ms 1 Yes Yes /classes/Product.php:4513
751
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (753) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.452 ms 1 Yes Yes /classes/Product.php:4513
32
SELECT SQL_NO_CACHE *
FROM `och438group` a
LEFT JOIN `och438group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.452 ms 1 /src/Adapter/EntityMapper.php:71
288
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.451 ms 0 /classes/Cart.php:1430
668
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2051) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
739
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2429) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.451 ms 1 Yes Yes /classes/Product.php:4513
299
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1469
AND image_shop.`cover` = 1 LIMIT 1
0.451 ms 1 /classes/Product.php:3570
688
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2465) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
778
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1378) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.450 ms 1 Yes Yes /classes/Product.php:4513
881
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c
WHERE c.`id_category` = 2 LIMIT 1
0.450 ms 1 /classes/Category.php:1589
167
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 745 LIMIT 1
0.450 ms 1 /classes/SpecificPrice.php:435
498
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2405 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2405 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.449 ms 0 /classes/Cart.php:1430
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM och438shop_group gs
LEFT JOIN och438shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN och438shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.449 ms 1 Yes /classes/shop/Shop.php:715
238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 769) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.448 ms 1 /classes/stock/StockAvailable.php:453
691
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2502) AND (b.`id_shop` = 1) LIMIT 1
0.447 ms 1 /src/Adapter/EntityMapper.php:71
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `och438lang` l
JOIN och438lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.446 ms 1 /classes/Language.php:1214
247
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2662 AND `id_group` = 1 LIMIT 1
0.446 ms 0 /classes/GroupReduction.php:153
802
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1622) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.446 ms 1 Yes Yes /classes/Product.php:4513
517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2447
ORDER BY f.position ASC
0.446 ms 1 Yes /classes/Product.php:6024
736
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (698) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.445 ms 1 Yes Yes /classes/Product.php:4513
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2429) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.444 ms 1 /classes/stock/StockAvailable.php:453
772
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2662) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.444 ms 1 Yes Yes /classes/Product.php:4513
685
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2447) AND (b.`id_shop` = 1) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
838
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2051) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.443 ms 1 Yes Yes /classes/Product.php:4513
180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 753) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.442 ms 1 /classes/stock/StockAvailable.php:453
276
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1471 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1471 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.442 ms 0 /classes/Cart.php:1430
22
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.441 ms 104 /classes/module/Module.php:341
374
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1285
AND image_shop.`cover` = 1 LIMIT 1
0.440 ms 1 /classes/Product.php:3570
697
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2554) AND (b.`id_shop` = 1) LIMIT 1
0.440 ms 1 /src/Adapter/EntityMapper.php:71
373
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1424
ORDER BY f.position ASC
0.440 ms 1 Yes /classes/Product.php:6024
730
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitreviews" LIMIT 1
0.439 ms 1 /classes/module/Module.php:2664
255
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1164 AND id_shop=1 LIMIT 1
0.437 ms 1 /classes/Product.php:6884
441
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2033 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2033 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.437 ms 0 /classes/Cart.php:1430
66
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM och438layered_category
WHERE controller = 'category'
AND id_category = 22
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.436 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
726
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.436 ms 1 /classes/module/Module.php:2137
566
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1717) AND (b.`id_shop` = 1) LIMIT 1
0.434 ms 1 /src/Adapter/EntityMapper.php:71
893
SELECT SQL_NO_CACHE data
FROM `och438ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.434 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:39
450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2052 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2052 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.433 ms 0 /classes/Cart.php:1430
345
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1622 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1622 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.432 ms 0 /classes/Cart.php:1430
705
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.432 ms 13 /classes/CartRule.php:357
650
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1719) AND (b.`id_shop` = 1) LIMIT 1
0.431 ms 1 /src/Adapter/EntityMapper.php:71
745
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2428) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.431 ms 1 Yes Yes /classes/Product.php:4513
423
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1866 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1866 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.430 ms 0 /classes/Cart.php:1430
605
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2662) AND (b.`id_shop` = 1) LIMIT 1
0.430 ms 1 /src/Adapter/EntityMapper.php:71
168
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 745)
0.430 ms 1 /classes/Product.php:3860
107
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1717 AND id_shop=1 LIMIT 1
0.429 ms 1 /classes/Product.php:6884
405
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1719 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1719 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.428 ms 0 /classes/Cart.php:1430
432
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1867 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1867 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.428 ms 0 /classes/Cart.php:1430
64
SELECT SQL_NO_CACHE `name`
FROM `och438hook`
WHERE `id_hook` = 746 LIMIT 1
0.428 ms 1 /classes/Hook.php:244
394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1718 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1718 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.427 ms 0 /classes/Cart.php:1430
577
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2427) AND (b.`id_shop` = 1) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
747
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 745 LIMIT 1
0.427 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
863
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2542
0.426 ms 2 /classes/Product.php:3420
317
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1350 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1350 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.425 ms 0 /classes/Cart.php:1430
326
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1482 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1482 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.425 ms 0 /classes/Cart.php:1430
555
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2554 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2554 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.424 ms 0 /classes/Cart.php:1430
671
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2316) AND (b.`id_shop` = 1) LIMIT 1
0.424 ms 1 /src/Adapter/EntityMapper.php:71
297
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1510 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1510 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2447 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2447 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.422 ms 0 /classes/Cart.php:1430
507
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2406 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2406 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.420 ms 0 /classes/Cart.php:1430
571
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 698) AND (b.`id_shop` = 1) LIMIT 1
0.418 ms 1 /src/Adapter/EntityMapper.php:71
674
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2319) AND (b.`id_shop` = 1) LIMIT 1
0.417 ms 1 /src/Adapter/EntityMapper.php:71
841
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2316) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.416 ms 1 Yes Yes /classes/Product.php:4513
19
SELECT SQL_NO_CACHE name, alias FROM `och438hook_alias`
0.415 ms 88 /classes/Hook.php:342
147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2427)
0.415 ms 1 /classes/Product.php:3860
384
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1285
ORDER BY f.position ASC
0.415 ms 1 Yes /classes/Product.php:6024
720
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `och438cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.414 ms 1 /classes/Cart.php:1300
205
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.414 ms 1 /classes/Product.php:5670
339
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1622) AND (b.`id_shop` = 1) LIMIT 1
0.414 ms 1 /src/Adapter/EntityMapper.php:71
446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2052)
0.414 ms 1 /classes/Product.php:3860
886
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.414 ms 1 /classes/module/Module.php:2137
62
SELECT SQL_NO_CACHE *
FROM `och438category` a0
LEFT JOIN `och438category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 7) AND (a0.`nright` > 40) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.413 ms 4 /classes/PrestaShopCollection.php:383
630
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1421) AND (b.`id_shop` = 1) LIMIT 1
0.413 ms 1 /src/Adapter/EntityMapper.php:71
706
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.413 ms 13 /classes/CartRule.php:357
414
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1795 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1795 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.412 ms 0 /classes/Cart.php:1430
477
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2319 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2319 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.412 ms 0 /classes/Cart.php:1430
7
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.411 ms 1 /src/Adapter/EntityMapper.php:71
585
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 753) AND (b.`id_shop` = 1) LIMIT 1
0.411 ms 1 /src/Adapter/EntityMapper.php:71
741
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2427 LIMIT 1
0.410 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM och438shop_url su
LEFT JOIN och438shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'farmacialanueva.online' OR su.domain_ssl = 'farmacialanueva.online')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.409 ms 1 Yes /classes/shop/Shop.php:1364
805
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1373) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.409 ms 1 Yes Yes /classes/Product.php:4513
307
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1469 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1469 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.408 ms 0 /classes/Cart.php:1430
709
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `och438currency` c
LEFT JOIN och438currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.408 ms 1 /classes/Currency.php:1134
856
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2447) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.408 ms 1 Yes Yes /classes/Product.php:4513
651
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1719
ORDER BY `position`
0.407 ms 1 Yes /classes/Product.php:3539
703
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c WHERE c.id_category = 22 LIMIT 1
0.407 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
301
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1469) AND (b.`id_shop` = 1) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
832
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2033) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.406 ms 1 Yes Yes /classes/Product.php:4513
534
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2502 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2502 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.404 ms 0 /classes/Cart.php:1430
335
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1421 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1421 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.404 ms 0 /classes/Cart.php:1430
591
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 757) AND (b.`id_shop` = 1) LIMIT 1
0.404 ms 1 /src/Adapter/EntityMapper.php:71
645
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1285
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3539
694
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2542) AND (b.`id_shop` = 1) LIMIT 1
0.403 ms 1 /src/Adapter/EntityMapper.php:71
835
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2052) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.403 ms 1 Yes Yes /classes/Product.php:4513
594
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 766) AND (b.`id_shop` = 1) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
807
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1477 LIMIT 1
0.402 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
853
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2406) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.402 ms 1 Yes Yes /classes/Product.php:4513
862
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2502) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.402 ms 1 Yes Yes /classes/Product.php:4513
680
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2405
ORDER BY `position`
0.400 ms 1 Yes /classes/Product.php:3539
216
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 767 LIMIT 1
0.399 ms 1 /classes/SpecificPrice.php:435
623
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1469
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3539
887
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitpopup" LIMIT 1
0.399 ms 1 /classes/module/Module.php:2664
214
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.398 ms 1 /classes/Product.php:5670
627
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1482) AND (b.`id_shop` = 1) LIMIT 1
0.398 ms 1 /src/Adapter/EntityMapper.php:71
660
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1867
ORDER BY `position`
0.398 ms 1 Yes /classes/Product.php:3539
793
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1350) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.398 ms 1 Yes Yes /classes/Product.php:4513
829
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1867) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.398 ms 1 Yes Yes /classes/Product.php:4513
154
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.397 ms 1 /classes/Product.php:5670
268
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1378
ORDER BY f.position ASC
0.397 ms 1 Yes /classes/Product.php:6024
850
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2405) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.397 ms 1 Yes Yes /classes/Product.php:4513
865
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.397 ms 1 Yes Yes /classes/Product.php:4513
23
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) AND (b.`id_shop` = 1) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
678
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2349
ORDER BY `position`
0.396 ms 1 Yes /classes/Product.php:3539
808
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1477) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.396 ms 1 Yes Yes /classes/Product.php:4513
840
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2316 LIMIT 1
0.396 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
844
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2319) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.396 ms 1 Yes Yes /classes/Product.php:4513
113
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1717 AND `id_group` = 1 LIMIT 1
0.395 ms 0 /classes/GroupReduction.php:153
614
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1471) AND (b.`id_shop` = 1) LIMIT 1
0.394 ms 1 /src/Adapter/EntityMapper.php:71
70
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) LIMIT 1
0.393 ms 1 /src/Adapter/EntityMapper.php:71
433
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1867
ORDER BY f.position ASC
0.392 ms 1 Yes /classes/Product.php:6024
654
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1795
ORDER BY `position`
0.392 ms 1 Yes /classes/Product.php:3539
125
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 698 AND id_shop=1 LIMIT 1
0.391 ms 1 /classes/Product.php:6884
525
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2465 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2465 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.390 ms 0 /classes/Cart.php:1430
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `och438lang` l
LEFT JOIN `och438lang_shop` ls ON (l.id_lang = ls.id_lang)
0.390 ms 1 /classes/Language.php:1080
277
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1471
ORDER BY f.position ASC
0.389 ms 1 Yes /classes/Product.php:6024
492
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2405) AND (b.`id_shop` = 1) LIMIT 1
0.389 ms 1 /src/Adapter/EntityMapper.php:71
460
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2051
ORDER BY f.position ASC
0.388 ms 1 Yes /classes/Product.php:6024
775
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1164) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.387 ms 1 Yes Yes /classes/Product.php:4513
890
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.387 ms 1 /classes/module/Module.php:2137
817
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1718) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.387 ms 1 Yes Yes /classes/Product.php:4513
611
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1378) AND (b.`id_shop` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2052
ORDER BY f.position ASC
0.384 ms 1 Yes /classes/Product.php:6024
620
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1510) AND (b.`id_shop` = 1) LIMIT 1
0.384 ms 1 /src/Adapter/EntityMapper.php:71
164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 745
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 2 /classes/Product.php:3570
574
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2429) AND (b.`id_shop` = 1) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
588
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2433) AND (b.`id_shop` = 1) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
617
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2521) AND (b.`id_shop` = 1) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
799
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1421) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.383 ms 1 Yes Yes /classes/Product.php:4513
744
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2428 LIMIT 1
0.382 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
740
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2427
0.382 ms 2 /classes/Product.php:3420
811
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1424) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.382 ms 1 Yes Yes /classes/Product.php:4513
311
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1350) AND (b.`id_shop` = 1) LIMIT 1
0.381 ms 1 /src/Adapter/EntityMapper.php:71
535
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2502
ORDER BY f.position ASC
0.381 ms 1 Yes /classes/Product.php:6024
826
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1866) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.381 ms 1 Yes Yes /classes/Product.php:4513
859
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2465) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.379 ms 1 Yes Yes /classes/Product.php:4513
734
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 698
0.379 ms 2 /classes/Product.php:3420
855
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2447 LIMIT 1
0.379 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
663
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2033
ORDER BY `position`
0.378 ms 3 Yes /classes/Product.php:3539
698
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2554
ORDER BY `position`
0.378 ms 3 Yes /classes/Product.php:3539
796
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1482) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.378 ms 1 Yes Yes /classes/Product.php:4513
820
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1719) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.378 ms 1 Yes Yes /classes/Product.php:4513
683
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2406
ORDER BY `position`
0.377 ms 3 Yes /classes/Product.php:3539
701
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2678
ORDER BY `position`
0.377 ms 1 Yes /classes/Product.php:3539
161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2428) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.376 ms 1 /classes/stock/StockAvailable.php:453
385
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1718
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1719
AND image_shop.`cover` = 1 LIMIT 1
0.376 ms 1 /classes/Product.php:3570
434
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2033
AND image_shop.`cover` = 1 LIMIT 1
0.375 ms 3 /classes/Product.php:3570
602
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 769) AND (b.`id_shop` = 1) LIMIT 1
0.375 ms 1 /src/Adapter/EntityMapper.php:71
710
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_languageselector" LIMIT 1
0.375 ms 1 /classes/module/Module.php:2664
783
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2521 LIMIT 1
0.375 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
639
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1477
ORDER BY `position`
0.375 ms 1 Yes /classes/Product.php:3539
707
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.374 ms 1 /classes/module/Module.php:2664
780
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1471 LIMIT 1
0.374 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
220
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 767) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
346
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1622
ORDER BY f.position ASC
0.373 ms 1 Yes /classes/Product.php:6024
546
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2542
ORDER BY f.position ASC
0.373 ms 1 Yes /classes/Product.php:6024
303
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1469)
0.373 ms 1 /classes/Product.php:3860
9
SELECT SQL_NO_CACHE *
FROM `och438lang` a
LEFT JOIN `och438lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.372 ms 1 /src/Adapter/EntityMapper.php:71
63
SELECT SQL_NO_CACHE * FROM och438revslider_sliders
0.371 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
489
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2349
ORDER BY f.position ASC
0.371 ms 1 Yes /classes/Product.php:6024
636
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1373
ORDER BY `position`
0.371 ms 1 Yes /classes/Product.php:3539
725
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.370 ms 1 /classes/module/Module.php:2664
888
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1
0.370 ms 1 /classes/module/Module.php:2137
583
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 745
ORDER BY `position`
0.368 ms 2 Yes /classes/Product.php:3539
565
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2678
ORDER BY f.position ASC
0.368 ms 1 Yes /classes/Product.php:6024
686
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2447
ORDER BY `position`
0.367 ms 1 Yes /classes/Product.php:3539
56
SELECT SQL_NO_CACHE * FROM `och438image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.367 ms 8 Yes /classes/ImageType.php:109
406
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1719
ORDER BY f.position ASC
0.367 ms 1 Yes /classes/Product.php:6024
442
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2033
ORDER BY f.position ASC
0.367 ms 1 Yes /classes/Product.php:6024
648
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1718
ORDER BY `position`
0.367 ms 1 Yes /classes/Product.php:3539
738
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2429 LIMIT 1
0.367 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
170
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 745 AND `id_group` = 1 LIMIT 1
0.366 ms 0 /classes/GroupReduction.php:153
415
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1795
ORDER BY f.position ASC
0.366 ms 1 Yes /classes/Product.php:6024
586
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 753
ORDER BY `position`
0.366 ms 2 Yes /classes/Product.php:3539
642
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1424
ORDER BY `position`
0.366 ms 1 Yes /classes/Product.php:3539
21
SELECT SQL_NO_CACHE * FROM `och438hook_module_exceptions`
WHERE `id_shop` IN (1)
0.365 ms 1 /classes/module/Module.php:2046
273
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1471 AND id_shop=1 LIMIT 1
0.365 ms 1 /classes/Product.php:6884
478
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2319
ORDER BY f.position ASC
0.365 ms 1 Yes /classes/Product.php:6024
625
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1350
ORDER BY `position`
0.364 ms 1 Yes /classes/Product.php:3539
464
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2316)
0.363 ms 1 /classes/Product.php:3860
469
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2316
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 753)
0.363 ms 1 /classes/Product.php:3860
889
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.363 ms 1 /classes/module/Module.php:2664
581
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2428
ORDER BY `position`
0.362 ms 1 Yes /classes/Product.php:3539
530
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2502)
0.362 ms 1 /classes/Product.php:3860
839
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2316
0.361 ms 4 /classes/Product.php:3420
541
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2542)
0.360 ms 1 /classes/Product.php:3860
597
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 767
ORDER BY `position`
0.360 ms 1 Yes /classes/Product.php:3539
298
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1510
ORDER BY f.position ASC
0.358 ms 1 Yes /classes/Product.php:6024
318
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1350
ORDER BY f.position ASC
0.358 ms 1 Yes /classes/Product.php:6024
284
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2521)
0.358 ms 1 /classes/Product.php:3860
735
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 698 LIMIT 1
0.358 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
289
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2521
ORDER BY f.position ASC
0.357 ms 1 Yes /classes/Product.php:6024
379
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1285)
0.357 ms 1 /classes/Product.php:3860
861
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2502 LIMIT 1
0.356 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
364
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1477
ORDER BY f.position ASC
0.356 ms 1 Yes /classes/Product.php:6024
424
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1866
ORDER BY f.position ASC
0.356 ms 1 Yes /classes/Product.php:6024
508
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2406
ORDER BY f.position ASC
0.356 ms 1 Yes /classes/Product.php:6024
556
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2554
ORDER BY f.position ASC
0.356 ms 1 Yes /classes/Product.php:6024
782
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2521
0.356 ms 2 /classes/Product.php:3420
143
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.355 ms 1 /classes/Product.php:5670
184
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 33 LIMIT 1
0.355 ms 1 /classes/Category.php:1373
395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1718
ORDER BY f.position ASC
0.355 ms 1 Yes /classes/Product.php:6024
600
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 768
ORDER BY `position`
0.355 ms 2 Yes /classes/Product.php:3539
272
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1471)
0.354 ms 1 /classes/Product.php:3860
410
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1795)
0.354 ms 1 /classes/Product.php:3860
657
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1866
ORDER BY `position`
0.354 ms 1 Yes /classes/Product.php:3539
860
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2502
0.353 ms 2 /classes/Product.php:3420
419
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1866)
0.353 ms 1 /classes/Product.php:3860
578
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2427
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3539
633
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1622
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3539
753
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2433 LIMIT 1
0.353 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
120
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 22 LIMIT 1
0.352 ms 1 /classes/Category.php:1373
187
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2433
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.352 ms 1 /classes/SpecificPrice.php:256
390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1718)
0.352 ms 1 /classes/Product.php:3860
536
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2542
AND image_shop.`cover` = 1 LIMIT 1
0.352 ms 2 /classes/Product.php:3570
293
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1510)
0.352 ms 1 /classes/Product.php:3860
615
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1471
ORDER BY `position`
0.352 ms 1 Yes /classes/Product.php:3539
777
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1378 LIMIT 1
0.352 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
618
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2521
ORDER BY `position`
0.351 ms 1 Yes /classes/Product.php:3539
695
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2542
ORDER BY `position`
0.351 ms 2 Yes /classes/Product.php:3539
27
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
336
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1421
ORDER BY f.position ASC
0.349 ms 1 Yes /classes/Product.php:6024
567
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1717
ORDER BY `position`
0.349 ms 1 Yes /classes/Product.php:3539
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM och438shop s
LEFT JOIN och438shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.348 ms 1 /classes/shop/Shop.php:214
59
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.348 ms 1 /src/Adapter/EntityMapper.php:71
281
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2521 LIMIT 1
0.348 ms 1 /classes/SpecificPrice.php:435
327
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1482
ORDER BY f.position ASC
0.347 ms 1 Yes /classes/Product.php:6024
278
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2521
AND image_shop.`cover` = 1 LIMIT 1
0.347 ms 1 /classes/Product.php:3570
737
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2429
0.347 ms 2 /classes/Product.php:3420
341
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1622)
0.346 ms 1 /classes/Product.php:3860
43
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) AND (b.`id_shop` = 1) LIMIT 1
0.346 ms 1 /src/Adapter/EntityMapper.php:71
526
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2465
ORDER BY f.position ASC
0.346 ms 1 Yes /classes/Product.php:6024
631
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1421
ORDER BY `position`
0.346 ms 1 Yes /classes/Product.php:3539
810
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1424 LIMIT 1
0.346 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
843
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2319 LIMIT 1
0.346 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
104
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1717
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.345 ms 0 /classes/SpecificPrice.php:256
729
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1717
0.345 ms 2 /classes/Product.php:3420
771
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2662 LIMIT 1
0.345 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
749
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 753
0.344 ms 2 /classes/Product.php:3420
770
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2662
0.344 ms 2 /classes/Product.php:3420
159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2428 AND id_shop=1 LIMIT 1
0.344 ms 1 /classes/Product.php:6884
17
SELECT SQL_NO_CACHE value FROM `och438configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.343 ms 1 /classes/shop/Shop.php:1183
160
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2428 AND `id_group` = 1 LIMIT 1
0.343 ms 0 /classes/GroupReduction.php:153
350
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1373)
0.343 ms 1 /classes/Product.php:3860
589
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2433
ORDER BY `position`
0.343 ms 1 Yes /classes/Product.php:3539
743
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2428
0.343 ms 2 /classes/Product.php:3420
732
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1717 LIMIT 1
0.343 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
356
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1477
AND image_shop.`cover` = 1 LIMIT 1
0.342 ms 1 /classes/Product.php:3570
499
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2405
ORDER BY f.position ASC
0.342 ms 1 Yes /classes/Product.php:6024
112
SELECT SQL_NO_CACHE *
FROM `och438tax_lang`
WHERE `id_tax` = 31
0.342 ms 1 /src/Adapter/EntityMapper.php:79
443
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2052
AND image_shop.`cover` = 1 LIMIT 1
0.342 ms 1 /classes/Product.php:3570
308
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1469
ORDER BY f.position ASC
0.340 ms 1 Yes /classes/Product.php:6024
313
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1350)
0.339 ms 1 /classes/Product.php:3860
71
SELECT SQL_NO_CACHE *
FROM `och438category_lang`
WHERE `id_category` = 22 AND `id_shop` = 1
0.338 ms 1 /src/Adapter/EntityMapper.php:79
367
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1424 LIMIT 1
0.338 ms 1 /classes/SpecificPrice.php:435
547
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2554
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 3 /classes/Product.php:3570
579
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2427
0.338 ms 1 /classes/Product.php:2899
606
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2662
ORDER BY `position`
0.338 ms 1 Yes /classes/Product.php:3539
804
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1373 LIMIT 1
0.338 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
60
SELECT SQL_NO_CACHE *
FROM `och438country_lang`
WHERE `id_country` = 6
0.338 ms 1 /src/Adapter/EntityMapper.php:79
347
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1373
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 1 /classes/Product.php:3570
470
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2319
AND image_shop.`cover` = 1 LIMIT 1
0.337 ms 1 /classes/Product.php:3570
831
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2033 LIMIT 1
0.336 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
290
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1510
AND image_shop.`cover` = 1 LIMIT 1
0.336 ms 1 /classes/Product.php:3570
490
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2405
AND image_shop.`cover` = 1 LIMIT 1
0.336 ms 1 /classes/Product.php:3570
646
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1285
0.336 ms 1 /classes/Product.php:2899
667
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2052
0.336 ms 1 /classes/Product.php:2899
365
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1424
AND image_shop.`cover` = 1 LIMIT 1
0.335 ms 1 /classes/Product.php:3570
114
SELECT SQL_NO_CACHE `reduction`
FROM `och438group`
WHERE `id_group` = 1 LIMIT 1
0.335 ms 1 /classes/Group.php:151
359
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1477)
0.335 ms 1 /classes/Product.php:3860
864
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2542 LIMIT 1
0.335 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `och438hook_alias`
0.334 ms 88 /classes/Hook.php:290
38
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 26) AND (b.`id_shop` = 1) LIMIT 1
0.334 ms 1 /src/Adapter/EntityMapper.php:71
49
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1
0.334 ms 1 /src/Adapter/EntityMapper.php:71
208
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 766 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6884
428
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1867)
0.334 ms 1 /classes/Product.php:3860
712
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.334 ms 1 /classes/module/Module.php:2664
29
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
437
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2033)
0.333 ms 1 /classes/Product.php:3860
609
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1164
ORDER BY `position`
0.333 ms 1 Yes /classes/Product.php:3539
666
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2052
ORDER BY `position`
0.333 ms 1 Yes /classes/Product.php:3539
692
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2502
ORDER BY `position`
0.333 ms 1 Yes /classes/Product.php:3539
236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 769 AND id_shop=1 LIMIT 1
0.332 ms 1 /classes/Product.php:6884
463
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2316 LIMIT 1
0.332 ms 1 /classes/SpecificPrice.php:435
473
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2319)
0.332 ms 1 /classes/Product.php:3860
418
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1866 LIMIT 1
0.332 ms 1 /classes/SpecificPrice.php:435
461
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2316
AND image_shop.`cover` = 1 LIMIT 1
0.332 ms 6 /classes/Product.php:3570
612
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1378
ORDER BY `position`
0.332 ms 1 Yes /classes/Product.php:3539
672
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2316
ORDER BY `position`
0.332 ms 6 Yes /classes/Product.php:3539
837
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2051 LIMIT 1
0.332 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
568
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1717
0.331 ms 1 /classes/Product.php:2899
708
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.331 ms 1 /classes/module/Module.php:2137
73
SELECT SQL_NO_CACHE data FROM och438layered_filter_block WHERE hash="7bfa9bc0ebf32408487961135cd19e03" LIMIT 1
0.331 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
331
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1421)
0.330 ms 1 /classes/Product.php:3860
637
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1373
0.330 ms 1 /classes/Product.php:2899
854
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2447
0.330 ms 2 /classes/Product.php:3420
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM och438shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.329 ms 1 /classes/shop/ShopUrl.php:178
47
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 94) AND (b.`id_shop` = 1) LIMIT 1
0.329 ms 1 /src/Adapter/EntityMapper.php:71
51
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 272) AND (b.`id_shop` = 1) LIMIT 1
0.329 ms 1 /src/Adapter/EntityMapper.php:71
218
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 767 AND id_shop=1 LIMIT 1
0.329 ms 1 /classes/Product.php:6884
368
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1424)
0.329 ms 1 /classes/Product.php:3860
572
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 698
ORDER BY `position`
0.329 ms 1 Yes /classes/Product.php:3539
834
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2052 LIMIT 1
0.329 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
269
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1471
AND image_shop.`cover` = 1 LIMIT 1
0.328 ms 1 /classes/Product.php:3570
387
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1718 LIMIT 1
0.328 ms 1 /classes/SpecificPrice.php:435
503
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2406)
0.328 ms 1 /classes/Product.php:3860
621
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1510
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
628
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1482
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
675
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2319
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
689
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2465
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
792
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1350 LIMIT 1
0.328 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
575
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2429
ORDER BY `position`
0.328 ms 1 Yes /classes/Product.php:3539
319
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1482
AND image_shop.`cover` = 1 LIMIT 1
0.327 ms 1 /classes/Product.php:3570
65
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.327 ms 1 /classes/Category.php:2446
455
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2051)
0.327 ms 1 /classes/Product.php:3860
595
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 766
ORDER BY `position`
0.326 ms 2 Yes /classes/Product.php:3539
264
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1378 AND id_shop=1 LIMIT 1
0.326 ms 1 /classes/Product.php:6884
382
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.326 ms 1 /classes/stock/StockAvailable.php:453
643
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1424
0.326 ms 1 /classes/Product.php:2899
45
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
0.325 ms 1 /src/Adapter/EntityMapper.php:71
42
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 41) AND (b.`id_shop` = 1) LIMIT 1
0.325 ms 1 /src/Adapter/EntityMapper.php:71
409
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1795 LIMIT 1
0.325 ms 1 /classes/SpecificPrice.php:435
669
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2051
ORDER BY `position`
0.325 ms 1 Yes /classes/Product.php:3539
684
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2406
0.325 ms 1 /classes/Product.php:2899
718
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsearch" LIMIT 1
0.325 ms 1 /classes/module/Module.php:2664
724
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.325 ms 1 /classes/module/Module.php:2137
467
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2316) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.324 ms 1 /classes/stock/StockAvailable.php:453
494
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2405)
0.324 ms 1 /classes/Product.php:3860
560
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2678)
0.324 ms 1 /classes/Product.php:3860
655
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1795
0.324 ms 1 /classes/Product.php:2899
39
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 29) AND (b.`id_shop` = 1) LIMIT 1
0.323 ms 1 /src/Adapter/EntityMapper.php:71
227
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 768 AND id_shop=1 LIMIT 1
0.323 ms 1 /classes/Product.php:6884
407
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1795
AND image_shop.`cover` = 1 LIMIT 1
0.323 ms 1 /classes/Product.php:3570
773
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1164
0.323 ms 3 /classes/Product.php:3420
801
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1622 LIMIT 1
0.323 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
592
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 757
ORDER BY `position`
0.323 ms 1 Yes /classes/Product.php:3539
815
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1718
0.323 ms 3 /classes/Product.php:3420
26
SELECT SQL_NO_CACHE c.id_currency
FROM `och438currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.322 ms 1 /classes/Currency.php:893
40
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
401
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1719)
0.322 ms 1 /classes/Product.php:3860
416
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1866
AND image_shop.`cover` = 1 LIMIT 1
0.322 ms 1 /classes/Product.php:3570
603
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 769
ORDER BY `position`
0.322 ms 1 Yes /classes/Product.php:3539
48
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
316
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.322 ms 1 /classes/stock/StockAvailable.php:453
652
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1719
0.322 ms 1 /classes/Product.php:2899
727
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.322 ms 1 /classes/module/Module.php:2664
176
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 753 LIMIT 1
0.321 ms 1 /classes/SpecificPrice.php:435
41
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
52
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 274) AND (b.`id_shop` = 1) LIMIT 1
0.320 ms 1 /src/Adapter/EntityMapper.php:71
833
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2052
0.320 ms 2 /classes/Product.php:3420
8
SELECT SQL_NO_CACHE *
FROM `och438shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.320 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.320 ms 1 /classes/SpecificPrice.php:256
291
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.320 ms 1 /classes/Product.php:5670
44
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 43) AND (b.`id_shop` = 1) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
190
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2433 AND id_shop=1 LIMIT 1
0.319 ms 1 /classes/Product.php:6884
425
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1867
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 1 /classes/Product.php:3570
500
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2406
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 3 /classes/Product.php:3570
721
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_shoppingcart" LIMIT 1
0.319 ms 1 /classes/module/Module.php:2664
46
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) AND (b.`id_shop` = 1) LIMIT 1
0.318 ms 1 /src/Adapter/EntityMapper.php:71
322
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1482)
0.318 ms 1 /classes/Product.php:3860
752
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2433
0.318 ms 2 /classes/Product.php:3420
849
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2405 LIMIT 1
0.318 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
50
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 138) AND (b.`id_shop` = 1) LIMIT 1
0.318 ms 1 /src/Adapter/EntityMapper.php:71
275
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:453
827
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1867
0.318 ms 2 /classes/Product.php:3420
24
SELECT SQL_NO_CACHE * FROM `och438currency` c ORDER BY `iso_code` ASC
0.317 ms 1 Yes /classes/Currency.php:708
149
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2427 AND `id_group` = 1 LIMIT 1
0.317 ms 0 /classes/GroupReduction.php:153
155
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2428 LIMIT 1
0.317 ms 1 /classes/SpecificPrice.php:435
779
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1471
0.317 ms 2 /classes/Product.php:3420
819
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1719 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
138
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2429 AND `id_group` = 1 LIMIT 1
0.317 ms 0 /classes/GroupReduction.php:153
185
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 33 LIMIT 1
0.317 ms 1 /classes/Product.php:5670
296
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1510) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.317 ms 1 /classes/stock/StockAvailable.php:453
813
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1285 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
825
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1866 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
828
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1867 LIMIT 1
0.317 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
358
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1477 LIMIT 1
0.316 ms 1 /classes/SpecificPrice.php:435
723
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.316 ms 1 /classes/module/Module.php:2664
512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2447)
0.316 ms 1 /classes/Product.php:3860
551
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2554)
0.316 ms 1 /classes/Product.php:3860
386
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.315 ms 1 /classes/Product.php:5670
328
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1421
AND image_shop.`cover` = 1 LIMIT 1
0.315 ms 1 /classes/Product.php:3570
375
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.315 ms 1 /classes/Product.php:5670
521
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2465)
0.315 ms 1 /classes/Product.php:3860
716
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcompare" LIMIT 1
0.315 ms 1 /classes/module/Module.php:2664
795
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1482 LIMIT 1
0.315 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
821
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1795
0.315 ms 4 /classes/Product.php:3420
822
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1795 LIMIT 1
0.315 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
4
SELECT SQL_NO_CACHE *
FROM `och438shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.314 ms 1 /src/Adapter/EntityMapper.php:71
196
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.314 ms 1 /classes/Product.php:5670
253
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1164 LIMIT 1
0.314 ms 1 /classes/SpecificPrice.php:435
391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1718 AND id_shop=1 LIMIT 1
0.314 ms 1 /classes/Product.php:6884
479
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2349
AND image_shop.`cover` = 1 LIMIT 1
0.314 ms 1 /classes/Product.php:3570
713
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.314 ms 1 /classes/module/Module.php:2137
131
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 41 LIMIT 1
0.313 ms 1 /classes/Category.php:1373
244
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2662 LIMIT 1
0.313 ms 1 /classes/SpecificPrice.php:435
285
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2521 AND id_shop=1 LIMIT 1
0.313 ms 1 /classes/Product.php:6884
465
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2316 AND id_shop=1 LIMIT 1
0.313 ms 1 /classes/Product.php:6884
484
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2349)
0.313 ms 1 /classes/Product.php:3860
687
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2447
0.313 ms 1 /classes/Product.php:2899
271
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1471 LIMIT 1
0.313 ms 1 /classes/SpecificPrice.php:435
337
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1622
AND image_shop.`cover` = 1 LIMIT 1
0.312 ms 1 /classes/Product.php:3570
852
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2406 LIMIT 1
0.312 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
95
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 130 LIMIT 1
0.311 ms 1 /classes/Category.php:1373
649
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1718
0.311 ms 1 /classes/Product.php:2899
242
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.310 ms 1 /classes/Product.php:5670
776
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1378
0.310 ms 3 /classes/Product.php:3420
527
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2502
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
33
SELECT SQL_NO_CACHE *
FROM `och438group_lang`
WHERE `id_group` = 1
0.309 ms 1 /src/Adapter/EntityMapper.php:79
156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2428
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.309 ms 1 /classes/SpecificPrice.php:256
200
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 757 AND `id_group` = 1 LIMIT 1
0.309 ms 0 /classes/GroupReduction.php:153
462
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.309 ms 1 /classes/Product.php:5670
557
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2678
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
699
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2554
0.309 ms 1 /classes/Product.php:2899
746
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 745
0.309 ms 2 /classes/Product.php:3420
376
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1285 LIMIT 1
0.308 ms 1 /classes/SpecificPrice.php:435
816
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1718 LIMIT 1
0.308 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
824
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1866
0.308 ms 2 /classes/Product.php:3420
309
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1350
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
427
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1867 LIMIT 1
0.308 ms 1 /classes/SpecificPrice.php:435
0
SELECT SQL_NO_CACHE * FROM och438memcached_servers
0.307 ms 1 /classes/cache/CacheMemcached.php:263
353
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1373) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.307 ms 1 /classes/stock/StockAvailable.php:453
99
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1717 LIMIT 1
0.307 ms 1 /classes/SpecificPrice.php:435
262
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1378 LIMIT 1
0.307 ms 1 /classes/SpecificPrice.php:435
28
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.306 ms 1 /classes/Language.php:880
661
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1867
0.306 ms 1 /classes/Product.php:2899
35
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.306 ms 1 /classes/Category.php:2446
274
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1471 AND `id_group` = 1 LIMIT 1
0.306 ms 0 /classes/GroupReduction.php:153
280
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.306 ms 1 /classes/Product.php:5670
624
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1469
0.306 ms 1 /classes/Product.php:2899
622
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1510
0.305 ms 1 /classes/Product.php:2899
225
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 768 LIMIT 1
0.305 ms 1 /classes/SpecificPrice.php:435
233
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.305 ms 1 /classes/Product.php:5670
340
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1622 LIMIT 1
0.305 ms 1 /classes/SpecificPrice.php:435
362
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:453
388
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1718
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.305 ms 0 /classes/SpecificPrice.php:256
411
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1795 AND id_shop=1 LIMIT 1
0.305 ms 1 /classes/Product.php:6884
848
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2405
0.305 ms 1 /classes/Product.php:3420
371
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1424) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.304 ms 1 /classes/stock/StockAvailable.php:453
634
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1622
0.304 ms 1 /classes/Product.php:2899
809
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1424
0.304 ms 2 /classes/Product.php:3420
279
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 29 LIMIT 1
0.303 ms 1 /classes/Category.php:1373
435
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.303 ms 1 /classes/Product.php:5670
584
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 745
0.303 ms 1 /classes/Product.php:2899
722
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 32 AND `id_shop` = 1 LIMIT 1
0.303 ms 1 /classes/module/Module.php:2137
728
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 64 AND `id_shop` = 1 LIMIT 1
0.303 ms 1 /classes/module/Module.php:2137
798
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1421 LIMIT 1
0.303 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
818
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1719
0.303 ms 4 /classes/Product.php:3420
842
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2319
0.303 ms 1 /classes/Product.php:3420
199
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 757 AND id_shop=1 LIMIT 1
0.303 ms 1 /classes/Product.php:6884
445
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2052 LIMIT 1
0.303 ms 1 /classes/SpecificPrice.php:435
53
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 275) AND (b.`id_shop` = 1) LIMIT 1
0.302 ms 1 /src/Adapter/EntityMapper.php:71
518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2465
AND image_shop.`cover` = 1 LIMIT 1
0.302 ms 1 /classes/Product.php:3570
544
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
563
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2678) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.302 ms 1 /classes/stock/StockAvailable.php:453
237
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 769 AND `id_group` = 1 LIMIT 1
0.302 ms 0 /classes/GroupReduction.php:153
607
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2662
0.301 ms 1 /classes/Product.php:2899
797
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1421
0.301 ms 2 /classes/Product.php:3420
858
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2465 LIMIT 1
0.301 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
342
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1622 AND id_shop=1 LIMIT 1
0.301 ms 1 /classes/Product.php:6884
632
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1421
0.301 ms 1 /classes/Product.php:2899
519
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.300 ms 1 /classes/Product.php:5670
132
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.300 ms 1 /classes/Product.php:5670
569
SELECT SQL_NO_CACHE state FROM och438feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.300 ms 1 /classes/FeatureFlag.php:105
836
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2051
0.299 ms 2 /classes/Product.php:3420
219
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 767 AND `id_group` = 1 LIMIT 1
0.299 ms 0 /classes/GroupReduction.php:153
369
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1424 AND id_shop=1 LIMIT 1
0.299 ms 1 /classes/Product.php:6884
554
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2554) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.299 ms 1 /classes/stock/StockAvailable.php:453
629
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1482
0.299 ms 1 /classes/Product.php:2899
679
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2349
0.299 ms 1 /classes/Product.php:2899
681
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2405
0.299 ms 1 /classes/Product.php:2899
794
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1482
0.299 ms 1 /classes/Product.php:3420
287
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.298 ms 1 /classes/stock/StockAvailable.php:453
344
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1622) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.298 ms 1 /classes/stock/StockAvailable.php:453
640
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1477
0.298 ms 1 /classes/Product.php:2899
812
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1285
0.298 ms 3 /classes/Product.php:3420
25
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.297 ms 1 /classes/Language.php:880
246
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2662 AND id_shop=1 LIMIT 1
0.297 ms 1 /classes/Product.php:6884
417
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.297 ms 1 /classes/Product.php:5670
466
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2316 AND `id_group` = 1 LIMIT 1
0.297 ms 0 /classes/GroupReduction.php:153
302
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1469 LIMIT 1
0.296 ms 1 /classes/SpecificPrice.php:435
613
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1378
0.296 ms 1 /classes/Product.php:2899
191
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2433 AND `id_group` = 1 LIMIT 1
0.296 ms 0 /classes/GroupReduction.php:153
851
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2406
0.296 ms 1 /classes/Product.php:3420
134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2429
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.295 ms 1 /classes/SpecificPrice.php:256
440
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2033) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.295 ms 1 /classes/stock/StockAvailable.php:453
731
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 83 AND `id_shop` = 1 LIMIT 1
0.295 ms 1 /classes/module/Module.php:2137
58
SELECT SQL_NO_CACHE `need_identification_number`
FROM `och438country`
WHERE `id_country` = 6 LIMIT 1
0.295 ms 1 /classes/Country.php:402
393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1718) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.295 ms 1 /classes/stock/StockAvailable.php:453
845
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2349
0.295 ms 2 /classes/Product.php:3420
55
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.294 ms 0 /classes/module/Module.php:2137
179
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 753 AND `id_group` = 1 LIMIT 1
0.294 ms 0 /classes/GroupReduction.php:153
449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2052) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.294 ms 1 /classes/stock/StockAvailable.php:453
830
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2033
0.294 ms 3 /classes/Product.php:3420
857
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2465
0.294 ms 3 /classes/Product.php:3420
366
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.293 ms 1 /classes/Product.php:5670
471
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.293 ms 1 /classes/Product.php:5670
576
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2429
0.293 ms 1 /classes/Product.php:2899
800
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1622
0.293 ms 1 /classes/Product.php:3420
803
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1373
0.293 ms 3 /classes/Product.php:3420
57
SELECT SQL_NO_CACHE format
FROM `och438address_format`
WHERE `id_country` = 6 LIMIT 1
0.292 ms 1 /classes/AddressFormat.php:653
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2429 AND id_shop=1 LIMIT 1
0.292 ms 1 /classes/Product.php:6884
422
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1866) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
702
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2678
0.292 ms 1 /classes/Product.php:2899
806
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1477
0.292 ms 2 /classes/Product.php:3420
165
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.292 ms 1 /classes/Product.php:5670
481
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2349 LIMIT 1
0.292 ms 1 /classes/SpecificPrice.php:435
121
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.291 ms 1 /classes/Product.php:5670
349
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1373 LIMIT 1
0.291 ms 1 /classes/SpecificPrice.php:435
380
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1285 AND id_shop=1 LIMIT 1
0.291 ms 1 /classes/Product.php:6884
676
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2319
0.291 ms 1 /classes/Product.php:2899
126
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 698 AND `id_group` = 1 LIMIT 1
0.290 ms 0 /classes/GroupReduction.php:153
30
SELECT SQL_NO_CACHE *
FROM `och438currency_lang`
WHERE `id_currency` = 1
0.290 ms 1 /src/Adapter/EntityMapper.php:79
31
SELECT SQL_NO_CACHE id_shop
FROM `och438currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.290 ms 1 /classes/ObjectModel.php:1727
103
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `to` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.290 ms 1 /classes/SpecificPrice.php:381
431
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1867) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
351
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1373 AND id_shop=1 LIMIT 1
0.289 ms 1 /classes/Product.php:6884
550
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2554 LIMIT 1
0.289 ms 1 /classes/SpecificPrice.php:435
122
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 14
AND `active` = 1 LIMIT 1
0.288 ms 1 /classes/Manufacturer.php:312
436
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2033 LIMIT 1
0.288 ms 1 /classes/SpecificPrice.php:435
559
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2678 LIMIT 1
0.288 ms 1 /classes/SpecificPrice.php:435
696
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2542
0.288 ms 1 /classes/Product.php:2899
144
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2427 LIMIT 1
0.287 ms 1 /classes/SpecificPrice.php:435
398
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1719 LIMIT 1
0.287 ms 1 /classes/SpecificPrice.php:435
444
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.287 ms 1 /classes/Product.php:5670
472
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2319 LIMIT 1
0.287 ms 1 /classes/SpecificPrice.php:435
206
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 766 LIMIT 1
0.287 ms 1 /classes/SpecificPrice.php:435
573
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 698
0.287 ms 1 /classes/Product.php:2899
314
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1350 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6884
429
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1867 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6884
438
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2033 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6884
664
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2033
0.286 ms 1 /classes/Product.php:2899
304
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1469 AND id_shop=1 LIMIT 1
0.286 ms 1 /classes/Product.php:6884
360
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1477 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6884
402
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1719 AND id_shop=1 LIMIT 1
0.285 ms 1 /classes/Product.php:6884
520
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2465 LIMIT 1
0.285 ms 1 /classes/SpecificPrice.php:435
306
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1469) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
377
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.284 ms 0 /classes/SpecificPrice.php:256
404
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
458
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2051) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
510
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.284 ms 1 /classes/Product.php:5670
320
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.283 ms 1 /classes/Product.php:5670
300
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.282 ms 1 /classes/Product.php:5670
399
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1719
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.282 ms 0 /classes/SpecificPrice.php:256
426
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.282 ms 1 /classes/Product.php:5670
457
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2051 AND `id_group` = 1 LIMIT 1
0.282 ms 0 /classes/GroupReduction.php:153
504
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2406 AND id_shop=1 LIMIT 1
0.282 ms 1 /classes/Product.php:6884
145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2427
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.282 ms 1 /classes/SpecificPrice.php:256
36
SELECT SQL_NO_CACHE ctg.`id_group`
FROM och438category_group ctg
WHERE ctg.`id_category` = 22 AND ctg.`id_group` = 1 LIMIT 1
0.281 ms 1 /classes/Category.php:1751
270
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.281 ms 1 /classes/Product.php:5670
292
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1510 LIMIT 1
0.281 ms 1 /classes/SpecificPrice.php:435
323
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1482 AND id_shop=1 LIMIT 1
0.281 ms 1 /classes/Product.php:6884
447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2052 AND id_shop=1 LIMIT 1
0.281 ms 1 /classes/Product.php:6884
325
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1482) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
598
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 767
0.281 ms 1 /classes/Product.php:2899
626
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1350
0.281 ms 1 /classes/Product.php:2899
421
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1866 AND `id_group` = 1 LIMIT 1
0.280 ms 0 /classes/GroupReduction.php:153
582
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2428
0.280 ms 1 /classes/Product.php:2899
348
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.279 ms 1 /classes/Product.php:5670
148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2427 AND id_shop=1 LIMIT 1
0.279 ms 1 /classes/Product.php:6884
294
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1510 AND id_shop=1 LIMIT 1
0.279 ms 1 /classes/Product.php:6884
334
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1421) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
430
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1867 AND `id_group` = 1 LIMIT 1
0.279 ms 0 /classes/GroupReduction.php:153
476
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2319) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
511
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2447 LIMIT 1
0.279 ms 1 /classes/SpecificPrice.php:435
538
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2542 LIMIT 1
0.279 ms 1 /classes/SpecificPrice.php:435
587
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 753
0.279 ms 1 /classes/Product.php:2899
690
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2465
0.279 ms 1 /classes/Product.php:2899
693
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2502
0.279 ms 1 /classes/Product.php:2899
513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2447 AND id_shop=1 LIMIT 1
0.278 ms 1 /classes/Product.php:6884
529
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2502 LIMIT 1
0.278 ms 1 /classes/SpecificPrice.php:435
714
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitwishlist" LIMIT 1
0.278 ms 1 /classes/module/Module.php:2664
310
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.277 ms 1 /classes/Product.php:5670
381
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1285 AND `id_group` = 1 LIMIT 1
0.277 ms 0 /classes/GroupReduction.php:153
397
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.277 ms 1 /classes/Product.php:5670
562
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2678 AND `id_group` = 1 LIMIT 1
0.277 ms 0 /classes/GroupReduction.php:153
658
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1866
0.277 ms 1 /classes/Product.php:2899
711
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.277 ms 1 /classes/module/Module.php:2137
670
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2051
0.277 ms 1 /classes/Product.php:2899
209
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 766 AND `id_group` = 1 LIMIT 1
0.276 ms 0 /classes/GroupReduction.php:153
286
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2521 AND `id_group` = 1 LIMIT 1
0.276 ms 0 /classes/GroupReduction.php:153
601
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 768
0.276 ms 1 /classes/Product.php:2899
312
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1350 LIMIT 1
0.275 ms 1 /classes/SpecificPrice.php:435
448
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2052 AND `id_group` = 1 LIMIT 1
0.275 ms 0 /classes/GroupReduction.php:153
482
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2349
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.275 ms 1 /classes/SpecificPrice.php:256
619
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2521
0.275 ms 1 /classes/Product.php:2899
10
SELECT SQL_NO_CACHE id_shop
FROM `och438lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.275 ms 1 /classes/ObjectModel.php:1727
330
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1421 LIMIT 1
0.275 ms 1 /classes/SpecificPrice.php:435
454
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2051 LIMIT 1
0.275 ms 1 /classes/SpecificPrice.php:435
537
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.275 ms 1 /classes/Product.php:5670
590
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2433
0.275 ms 1 /classes/Product.php:2899
604
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 769
0.275 ms 1 /classes/Product.php:2899
453
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.274 ms 1 /classes/Product.php:5670
485
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2349 AND id_shop=1 LIMIT 1
0.274 ms 1 /classes/Product.php:6884
497
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2405) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
593
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 757
0.274 ms 1 /classes/Product.php:2899
96
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 130 LIMIT 1
0.274 ms 1 /classes/Product.php:5670
175
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.274 ms 1 /classes/Product.php:5670
178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 753 AND id_shop=1 LIMIT 1
0.274 ms 1 /classes/Product.php:6884
329
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.274 ms 1 /classes/Product.php:5670
487
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
493
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2405 LIMIT 1
0.274 ms 1 /classes/SpecificPrice.php:435
596
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 766
0.274 ms 1 /classes/Product.php:2899
420
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1866 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6884
474
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2319 AND id_shop=1 LIMIT 1
0.273 ms 1 /classes/Product.php:6884
610
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1164
0.273 ms 1 /classes/Product.php:2899
719
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.272 ms 1 /classes/module/Module.php:2137
97
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 70
AND `active` = 1 LIMIT 1
0.271 ms 1 /classes/Manufacturer.php:312
321
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1482 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
524
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2465) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.271 ms 1 /classes/stock/StockAvailable.php:453
715
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.271 ms 1 /classes/module/Module.php:2137
61
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM och438required_field
0.270 ms 1 /classes/ObjectModel.php:1592
408
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.270 ms 1 /classes/Product.php:5670
502
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2406 LIMIT 1
0.270 ms 1 /classes/SpecificPrice.php:435
515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2447) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
34
SELECT SQL_NO_CACHE id_shop
FROM `och438group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.270 ms 1 /classes/ObjectModel.php:1727
491
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.270 ms 1 /classes/Product.php:5670
506
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2406) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.270 ms 1 /classes/stock/StockAvailable.php:453
548
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.270 ms 1 /classes/Product.php:5670
549
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 127
AND `active` = 1 LIMIT 1
0.270 ms 1 /classes/Manufacturer.php:312
357
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
539
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:256
352
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1373 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:153
456
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2051 AND id_shop=1 LIMIT 1
0.268 ms 1 /classes/Product.php:6884
332
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1421 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6884
338
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
361
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1477 AND `id_group` = 1 LIMIT 1
0.267 ms 0 /classes/GroupReduction.php:153
480
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
561
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2678 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6884
370
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1424 AND `id_group` = 1 LIMIT 1
0.266 ms 0 /classes/GroupReduction.php:153
501
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.266 ms 1 /classes/Product.php:5670
616
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1471
0.266 ms 1 /classes/Product.php:2899
673
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2316
0.266 ms 1 /classes/Product.php:2899
295
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1510 AND `id_group` = 1 LIMIT 1
0.266 ms 0 /classes/GroupReduction.php:153
475
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2319 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:153
570
SELECT SQL_NO_CACHE * FROM `och438image_type`
0.265 ms 8 /classes/ImageType.php:161
542
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2542 AND id_shop=1 LIMIT 1
0.265 ms 1 /classes/Product.php:6884
412
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1795 AND `id_group` = 1 LIMIT 1
0.264 ms 0 /classes/GroupReduction.php:153
552
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2554 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6884
403
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1719 AND `id_group` = 1 LIMIT 1
0.262 ms 0 /classes/GroupReduction.php:153
343
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1622 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:153
533
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2502) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.261 ms 1 /classes/stock/StockAvailable.php:453
315
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1350 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:153
324
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1482 AND `id_group` = 1 LIMIT 1
0.260 ms 0 /classes/GroupReduction.php:153
558
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.260 ms 1 /classes/Product.php:5670
392
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1718 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:153
439
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2033 AND `id_group` = 1 LIMIT 1
0.259 ms 0 /classes/GroupReduction.php:153
333
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1421 AND `id_group` = 1 LIMIT 1
0.258 ms 0 /classes/GroupReduction.php:153
486
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2349 AND `id_group` = 1 LIMIT 1
0.257 ms 0 /classes/GroupReduction.php:153
305
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1469 AND `id_group` = 1 LIMIT 1
0.256 ms 0 /classes/GroupReduction.php:153
522
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2465 AND id_shop=1 LIMIT 1
0.256 ms 1 /classes/Product.php:6884
495
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2405 AND id_shop=1 LIMIT 1
0.255 ms 1 /classes/Product.php:6884
532
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2502 AND `id_group` = 1 LIMIT 1
0.251 ms 0 /classes/GroupReduction.php:153
543
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2542 AND `id_group` = 1 LIMIT 1
0.251 ms 0 /classes/GroupReduction.php:153
505
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2406 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:153
531
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2502 AND id_shop=1 LIMIT 1
0.249 ms 1 /classes/Product.php:6884
553
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2554 AND `id_group` = 1 LIMIT 1
0.249 ms 0 /classes/GroupReduction.php:153
496
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2405 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:153
514
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2447 AND `id_group` = 1 LIMIT 1
0.244 ms 0 /classes/GroupReduction.php:153
523
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2465 AND `id_group` = 1 LIMIT 1
0.235 ms 0 /classes/GroupReduction.php:153

Doubles

48 queries
SELECT XX FROM `ochXXspecific_price` WHERE id_product = XX LIMIT XX
47 queries
SELECT image_shop.`id_image`
                    FROM `ochXXimage` i
                     INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
47 queries
SELECT name FROM ochXXcategory_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
47 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ochXXproduct` p
INNER JOIN `ochXXproduct_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `ochXXproduct_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
47 queries
                            SELECT `id_tax_rules_group`
                            FROM `ochXXproduct_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
47 queries
			SELECT `reduction`
			FROM `ochXXproduct_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
47 queries
SELECT SUM(quantity)
FROM `ochXXstock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
47 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `ochXXcart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `ochXXcart_product` cp JOIN `ochXXpack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ochXXproduct` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
47 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM ochXXfeature_product pf
                LEFT JOIN ochXXfeature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN ochXXfeature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN ochXXfeature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN ochXXfeature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
47 queries
SELECT *
FROM `ochXXproduct` a
LEFT JOIN `ochXXproduct_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `ochXXproduct_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
47 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `ochXXimage` i
             INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `ochXXimage_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
47 queries
SELECT `id_product_attribute`
            FROM `ochXXproduct_attribute`
            WHERE `id_product` = XX
47 queries
                SELECT `id_category` FROM `ochXXcategory_product`
                WHERE `id_product` = XX
47 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `ochXXiqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
47 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `ochXXproduct_attribute` pa
             INNER JOIN ochXXproduct_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `ochXXproduct_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `ochXXattribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `ochXXattribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
18 queries
SELECT *
FROM `ochXXcategory` a
LEFT JOIN `ochXXcategory_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `ochXXcategory_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
18 queries
SELECT `id_module` FROM `ochXXmodule_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
11 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `ochXXspecific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
11 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `ochXXspecific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
5 queries
			SELECT cl.`link_rewrite`
			FROM `ochXXcategory_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `ochXXattribute_group` ag INNER JOIN `ochXXattribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `ochXXattribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN ochXXattribute_group_shop attribute_group_shop
        ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX)  INNER JOIN ochXXattribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `ochXXlayered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
4 queries
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN ochXXattribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
4 queries
				SELECT `name`
				FROM `ochXXmanufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `ochXXmodule` m
                LEFT JOIN `ochXXmodule_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `ochXXlang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `ochXXcategory_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `ochXXmanufacturer` m INNER JOIN ochXXmanufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `ochXXmanufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN ochXXfeature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
2 queries
				SELECT tr.*
				FROM `ochXXtax_rule` tr
				JOIN `ochXXtax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT XX FROM `ochXXcart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

156 product
156 product_shop
110 product_attribute
96 cart_product
94 image
94 image_shop
94 product_attribute_shop
79 category_lang
64 specific_price
63 product_attribute_combination
63 category_product
60 stock_available
55 attribute
52 attribute_group
51 attribute_lang
49 feature_product
48 feature
48 feature_shop
48 feature_lang
48 product_lang
47 product_group_reduction_cache
47 pack
47 feature_value_lang
47 image_lang
47 iqitreviews_products
43 category
25 category_shop
22 module
21 module_shop
17 category_group
12 product_sale
11 specific_price_priority
7 hook
6 manufacturer
5 lang
5 currency
5 attribute_group_shop
5 attribute_group_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 attribute_shop
4 layered_indexable_attribute_lang_value
3 country
3 hook_alias
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 manufacturer_shop
2 manufacturer_lang
2 tax_rule
2 tax_rules_group
2 iqit_elementor_category
2 cart_rule
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 layered_category
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 tax
1 tax_lang
1 feature_flag
1 iqit_elementor_category_shop
1 connections
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 59 /classes/Link.php:113 (__construct) [id: 745]
/classes/Link.php:113 (__construct) [id: 767]
/classes/Link.php:113 (__construct) [id: 1469]
/classes/Link.php:113 (__construct) [id: 1350]
/classes/Link.php:113 (__construct) [id: 1622]
/classes/Link.php:113 (__construct) [id: 2405]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1717]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 698]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2429]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2427]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2428]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 745]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 753]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2433]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 757]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 766]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 767]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 768]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 769]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2662]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1164]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1378]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1471]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2521]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1510]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1469]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1350]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1482]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1421]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1622]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1373]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1477]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1424]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1285]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1718]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1719]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1795]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1866]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1867]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2033]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2052]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2051]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2316]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2319]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2349]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2405]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2406]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2447]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2465]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2502]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2542]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2554]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2678]
/classes/Link.php:113 (__construct) [id: 745]
/classes/Link.php:113 (__construct) [id: 767]
/classes/Link.php:113 (__construct) [id: 1469]
/classes/Link.php:113 (__construct) [id: 1350]
/classes/Link.php:113 (__construct) [id: 1622]
/classes/Link.php:113 (__construct) [id: 2405]
Category 23 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 22]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 26]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 29]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 41]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 42]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 43]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 45]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 94]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 130]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 131]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 138]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 272]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 274]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 275]
/classes/Meta.php:379 (__construct) [id: 22]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 22]
/modules/ps_facetedsearch/src/Filters/Block.php:158 (__construct) [id: 22]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1768 (__construct) [id: 0]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Tax 1 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 31]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /classes/Smarty/SmartyDev.php
199 /vendor/smarty/smarty/libs/Smarty.class.php
200 /vendor/smarty/smarty/libs/functions.php
201 /vendor/smarty/smarty/libs/Autoloader.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
211 /config/smartyfront.config.inc.php
212 /classes/Smarty/SmartyResourceModule.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
215 /classes/Smarty/SmartyResourceParent.php
216 /classes/Smarty/SmartyLazyRegister.php
217 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
218 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
219 /classes/Customer.php
220 /classes/Group.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /classes/Dispatcher.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
231 /src/Adapter/SymfonyContainer.php
232 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
233 /src/Adapter/ContainerBuilder.php
234 /src/Adapter/Environment.php
235 /src/Core/EnvironmentInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
237 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
238 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
239 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
240 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
241 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
245 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
246 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
247 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
248 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
249 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
250 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
252 /vendor/symfony/contracts/Service/ResetInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
255 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
256 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
258 /vendor/symfony/contracts/Cache/ItemInterface.php
259 /vendor/psr/cache/src/CacheItemInterface.php
260 /vendor/psr/cache/src/CacheItemPoolInterface.php
261 /vendor/symfony/contracts/Cache/CacheInterface.php
262 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
264 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
266 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
267 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
268 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
269 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
270 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
271 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
319 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
321 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
323 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
324 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
325 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
326 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
330 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
331 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
332 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
333 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
334 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
335 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
336 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
337 /var/cache/dev/FrontContainer.php
338 /src/Adapter/Container/LegacyContainer.php
339 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
340 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
341 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
342 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
343 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
344 /vendor/psr/container/src/ContainerExceptionInterface.php
345 /vendor/psr/container/src/NotFoundExceptionInterface.php
346 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
347 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
348 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
349 /src/Adapter/Container/LegacyContainerInterface.php
350 /modules/blockwishlist/vendor/autoload.php
351 /modules/blockwishlist/vendor/composer/autoload_real.php
352 /modules/blockwishlist/vendor/composer/autoload_static.php
353 /modules/contactform/vendor/autoload.php
354 /modules/contactform/vendor/composer/autoload_real.php
355 /modules/contactform/vendor/composer/autoload_static.php
356 /modules/dashactivity/vendor/autoload.php
357 /modules/dashactivity/vendor/composer/autoload_real.php
358 /modules/dashactivity/vendor/composer/platform_check.php
359 /modules/dashactivity/vendor/composer/autoload_static.php
360 /modules/dashtrends/vendor/autoload.php
361 /modules/dashtrends/vendor/composer/autoload_real.php
362 /modules/dashtrends/vendor/composer/autoload_static.php
363 /modules/dashgoals/vendor/autoload.php
364 /modules/dashgoals/vendor/composer/autoload_real.php
365 /modules/dashgoals/vendor/composer/platform_check.php
366 /modules/dashgoals/vendor/composer/autoload_static.php
367 /modules/dashproducts/vendor/autoload.php
368 /modules/dashproducts/vendor/composer/autoload_real.php
369 /modules/dashproducts/vendor/composer/platform_check.php
370 /modules/dashproducts/vendor/composer/autoload_static.php
371 /modules/graphnvd3/vendor/autoload.php
372 /modules/graphnvd3/vendor/composer/autoload_real.php
373 /modules/graphnvd3/vendor/composer/autoload_static.php
374 /modules/gridhtml/vendor/autoload.php
375 /modules/gridhtml/vendor/composer/autoload_real.php
376 /modules/gridhtml/vendor/composer/autoload_static.php
377 /modules/gsitemap/vendor/autoload.php
378 /modules/gsitemap/vendor/composer/autoload_real.php
379 /modules/gsitemap/vendor/composer/platform_check.php
380 /modules/gsitemap/vendor/composer/autoload_static.php
381 /modules/pagesnotfound/vendor/autoload.php
382 /modules/pagesnotfound/vendor/composer/autoload_real.php
383 /modules/pagesnotfound/vendor/composer/platform_check.php
384 /modules/pagesnotfound/vendor/composer/autoload_static.php
385 /modules/productcomments/vendor/autoload.php
386 /modules/productcomments/vendor/composer/autoload_real.php
387 /modules/productcomments/vendor/composer/platform_check.php
388 /modules/productcomments/vendor/composer/autoload_static.php
389 /modules/ps_categorytree/vendor/autoload.php
390 /modules/ps_categorytree/vendor/composer/autoload_real.php
391 /modules/ps_categorytree/vendor/composer/platform_check.php
392 /modules/ps_categorytree/vendor/composer/autoload_static.php
393 /modules/ps_checkpayment/vendor/autoload.php
394 /modules/ps_checkpayment/vendor/composer/autoload_real.php
395 /modules/ps_checkpayment/vendor/composer/autoload_static.php
396 /modules/ps_crossselling/vendor/autoload.php
397 /modules/ps_crossselling/vendor/composer/autoload_real.php
398 /modules/ps_crossselling/vendor/composer/platform_check.php
399 /modules/ps_crossselling/vendor/composer/autoload_static.php
400 /modules/ps_currencyselector/vendor/autoload.php
401 /modules/ps_currencyselector/vendor/composer/autoload_real.php
402 /modules/ps_currencyselector/vendor/composer/autoload_static.php
403 /modules/ps_customeraccountlinks/vendor/autoload.php
404 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
405 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
406 /modules/ps_customersignin/vendor/autoload.php
407 /modules/ps_customersignin/vendor/composer/autoload_real.php
408 /modules/ps_customersignin/vendor/composer/autoload_static.php
409 /modules/ps_dataprivacy/vendor/autoload.php
410 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
411 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
412 /modules/ps_emailsubscription/vendor/autoload.php
413 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
414 /modules/ps_emailsubscription/vendor/composer/platform_check.php
415 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
416 /modules/ps_faviconnotificationbo/vendor/autoload.php
417 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
418 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
419 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
420 /modules/ps_languageselector/vendor/autoload.php
421 /modules/ps_languageselector/vendor/composer/autoload_real.php
422 /modules/ps_languageselector/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_wirepayment/vendor/autoload.php
430 /modules/ps_wirepayment/vendor/composer/autoload_real.php
431 /modules/ps_wirepayment/vendor/composer/platform_check.php
432 /modules/ps_wirepayment/vendor/composer/autoload_static.php
433 /modules/statsbestcategories/vendor/autoload.php
434 /modules/statsbestcategories/vendor/composer/autoload_real.php
435 /modules/statsbestcategories/vendor/composer/platform_check.php
436 /modules/statsbestcategories/vendor/composer/autoload_static.php
437 /modules/statsbestcustomers/vendor/autoload.php
438 /modules/statsbestcustomers/vendor/composer/autoload_real.php
439 /modules/statsbestcustomers/vendor/composer/platform_check.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestproducts/vendor/autoload.php
442 /modules/statsbestproducts/vendor/composer/autoload_real.php
443 /modules/statsbestproducts/vendor/composer/platform_check.php
444 /modules/statsbestproducts/vendor/composer/autoload_static.php
445 /modules/statsbestsuppliers/vendor/autoload.php
446 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
447 /modules/statsbestsuppliers/vendor/composer/platform_check.php
448 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
449 /modules/statsbestvouchers/vendor/autoload.php
450 /modules/statsbestvouchers/vendor/composer/autoload_real.php
451 /modules/statsbestvouchers/vendor/composer/platform_check.php
452 /modules/statsbestvouchers/vendor/composer/autoload_static.php
453 /modules/statscarrier/vendor/autoload.php
454 /modules/statscarrier/vendor/composer/autoload_real.php
455 /modules/statscarrier/vendor/composer/platform_check.php
456 /modules/statscarrier/vendor/composer/autoload_static.php
457 /modules/statscatalog/vendor/autoload.php
458 /modules/statscatalog/vendor/composer/autoload_real.php
459 /modules/statscatalog/vendor/composer/platform_check.php
460 /modules/statscatalog/vendor/composer/autoload_static.php
461 /modules/statscheckup/vendor/autoload.php
462 /modules/statscheckup/vendor/composer/autoload_real.php
463 /modules/statscheckup/vendor/composer/platform_check.php
464 /modules/statscheckup/vendor/composer/autoload_static.php
465 /modules/statsdata/vendor/autoload.php
466 /modules/statsdata/vendor/composer/autoload_real.php
467 /modules/statsdata/vendor/composer/autoload_static.php
468 /modules/statsforecast/vendor/autoload.php
469 /modules/statsforecast/vendor/composer/autoload_real.php
470 /modules/statsforecast/vendor/composer/platform_check.php
471 /modules/statsforecast/vendor/composer/autoload_static.php
472 /modules/statsnewsletter/vendor/autoload.php
473 /modules/statsnewsletter/vendor/composer/autoload_real.php
474 /modules/statsnewsletter/vendor/composer/platform_check.php
475 /modules/statsnewsletter/vendor/composer/autoload_static.php
476 /modules/statspersonalinfos/vendor/autoload.php
477 /modules/statspersonalinfos/vendor/composer/autoload_real.php
478 /modules/statspersonalinfos/vendor/composer/platform_check.php
479 /modules/statspersonalinfos/vendor/composer/autoload_static.php
480 /modules/statsproduct/vendor/autoload.php
481 /modules/statsproduct/vendor/composer/autoload_real.php
482 /modules/statsproduct/vendor/composer/platform_check.php
483 /modules/statsproduct/vendor/composer/autoload_static.php
484 /modules/statsregistrations/vendor/autoload.php
485 /modules/statsregistrations/vendor/composer/autoload_real.php
486 /modules/statsregistrations/vendor/composer/platform_check.php
487 /modules/statsregistrations/vendor/composer/autoload_static.php
488 /modules/statssales/vendor/autoload.php
489 /modules/statssales/vendor/composer/autoload_real.php
490 /modules/statssales/vendor/composer/platform_check.php
491 /modules/statssales/vendor/composer/autoload_static.php
492 /modules/statssearch/vendor/autoload.php
493 /modules/statssearch/vendor/composer/autoload_real.php
494 /modules/statssearch/vendor/composer/platform_check.php
495 /modules/statssearch/vendor/composer/autoload_static.php
496 /modules/statsstock/vendor/autoload.php
497 /modules/statsstock/vendor/composer/autoload_real.php
498 /modules/statsstock/vendor/composer/platform_check.php
499 /modules/statsstock/vendor/composer/autoload_static.php
500 /modules/psgdpr/vendor/autoload.php
501 /modules/psgdpr/vendor/composer/autoload_real.php
502 /modules/psgdpr/vendor/composer/autoload_static.php
503 /modules/ps_facetedsearch/vendor/autoload.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
505 /modules/ps_facetedsearch/vendor/composer/platform_check.php
506 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
507 /modules/iqitsociallogin/vendor/autoload.php
508 /modules/iqitsociallogin/vendor/composer/autoload_real.php
509 /modules/iqitsociallogin/vendor/composer/platform_check.php
510 /modules/iqitsociallogin/vendor/composer/autoload_static.php
511 /modules/ps_emailalerts/vendor/autoload.php
512 /modules/ps_emailalerts/vendor/composer/autoload_real.php
513 /modules/ps_emailalerts/vendor/composer/autoload_static.php
514 /modules/ps_googleanalytics/vendor/autoload.php
515 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
516 /modules/ps_googleanalytics/vendor/composer/platform_check.php
517 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
518 /modules/ph_simpleblog/vendor/autoload.php
519 /modules/ph_simpleblog/vendor/composer/autoload_real.php
520 /modules/ph_simpleblog/vendor/composer/platform_check.php
521 /modules/ph_simpleblog/vendor/composer/autoload_static.php
522 /modules/autoupgrade/vendor/autoload.php
523 /modules/autoupgrade/vendor/composer/autoload_real.php
524 /modules/autoupgrade/vendor/composer/autoload_static.php
525 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
526 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
527 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
528 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
529 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
530 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
531 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
532 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
533 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
534 /modules/iqitproductflags/vendor/autoload.php
535 /modules/iqitproductflags/vendor/composer/autoload_real.php
536 /modules/iqitproductflags/vendor/composer/platform_check.php
537 /modules/iqitproductflags/vendor/composer/autoload_static.php
538 /modules/iqitproductvariants/vendor/autoload.php
539 /modules/iqitproductvariants/vendor/composer/autoload_real.php
540 /modules/iqitproductvariants/vendor/composer/autoload_static.php
541 /src/Core/Hook/HookModuleFilter.php
542 /src/Core/Hook/HookModuleFilterInterface.php
543 /modules/ph_simpleblog/ph_simpleblog.php
544 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
545 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
546 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
547 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
548 /modules/ph_simpleblog/models/SimpleBlogCategory.php
549 /modules/ph_simpleblog/models/SimpleBlogPost.php
550 /modules/ph_simpleblog/models/SimpleBlogPostType.php
551 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
552 /modules/ph_simpleblog/models/SimpleBlogTag.php
553 /modules/ph_simpleblog/models/SimpleBlogComment.php
554 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
555 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
556 /modules/ph_simpleblog/classes/BlogPostsFinder.php
557 /modules/ph_simpleblog/controllers/front/default_list.php
558 /classes/controller/ModuleFrontController.php
559 /override/classes/controller/FrontController.php
560 /classes/controller/FrontController.php
561 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
562 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
563 /classes/Translate.php
564 /modules/ph_simpleblog/translations/es.php
565 /src/PrestaShopBundle/Translation/TranslatorComponent.php
566 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
567 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
568 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
569 /vendor/symfony/contracts/Translation/TranslatorInterface.php
570 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
571 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
572 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
573 /src/PrestaShopBundle/Translation/TranslatorInterface.php
574 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
575 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
576 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
577 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
578 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
579 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
580 /vendor/symfony/contracts/Translation/TranslatorTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
582 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
583 /var/cache/dev/translations/catalogue.es-ES.NXhscRe.php
584 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
585 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
587 /controllers/front/listing/CategoryController.php
588 /classes/controller/ProductListingFrontController.php
589 /classes/controller/ProductPresentingFrontController.php
590 /src/Adapter/Presenter/Object/ObjectPresenter.php
591 /src/Adapter/Presenter/PresenterInterface.php
592 /src/Adapter/Presenter/Cart/CartPresenter.php
593 /src/Adapter/Image/ImageRetriever.php
594 /classes/tax/TaxConfiguration.php
595 /classes/Smarty/TemplateFinder.php
596 /classes/assets/StylesheetManager.php
597 /classes/assets/AbstractAssetManager.php
598 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
599 /classes/assets/JavascriptManager.php
600 /classes/assets/CccReducer.php
601 /modules/iqitthemeeditor/iqitthemeeditor.php
602 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
603 /modules/iqitthemeeditor/translations/es.php
604 /classes/Category.php
605 /classes/webservice/WebserviceRequest.php
606 /src/Core/Localization/Locale/Repository.php
607 /src/Core/Localization/Locale/RepositoryInterface.php
608 /src/Core/Localization/CLDR/LocaleRepository.php
609 /src/Core/Localization/CLDR/LocaleDataSource.php
610 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
611 /src/Core/Data/Layer/AbstractDataLayer.php
612 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
613 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
614 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
615 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
616 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
617 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
618 /vendor/symfony/contracts/Cache/CacheTrait.php
619 /vendor/psr/cache/src/InvalidArgumentException.php
620 /vendor/psr/cache/src/CacheException.php
621 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
622 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
623 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
624 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
625 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
626 /src/Core/Localization/CLDR/Reader.php
627 /src/Core/Localization/CLDR/ReaderInterface.php
628 /src/Core/Localization/Currency/Repository.php
629 /src/Core/Localization/Currency/RepositoryInterface.php
630 /src/Core/Localization/Currency/CurrencyDataSource.php
631 /src/Core/Localization/Currency/DataSourceInterface.php
632 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
633 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
634 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
635 /src/Adapter/Currency/CurrencyDataProvider.php
636 /src/Core/Currency/CurrencyDataProviderInterface.php
637 /src/Adapter/LegacyContext.php
638 /src/Adapter/Tools.php
639 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
640 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
641 /vendor/prestashop/decimal/src/Operation/Rounding.php
642 /src/Core/Localization/Locale.php
643 /src/Core/Localization/LocaleInterface.php
644 /src/Core/Localization/Specification/Price.php
645 /src/Core/Localization/Specification/Number.php
646 /src/Core/Localization/Specification/NumberInterface.php
647 /src/Core/Localization/Specification/Factory.php
648 /src/Core/Localization/CLDR/LocaleData.php
649 /src/Core/Localization/CLDR/NumberSymbolsData.php
650 /src/Core/Localization/CLDR/CurrencyData.php
651 /src/Core/Localization/CLDR/Locale.php
652 /src/Core/Localization/CLDR/LocaleInterface.php
653 /src/Core/Localization/Specification/NumberSymbolList.php
654 /classes/Currency.php
655 /src/Core/Localization/Currency/LocalizedCurrencyId.php
656 /src/Core/Localization/Currency/CurrencyData.php
657 /src/Core/Localization/Currency/CurrencyCollection.php
658 /src/Core/Localization/Currency.php
659 /src/Core/Localization/CurrencyInterface.php
660 /src/Core/Localization/Specification/NumberCollection.php
661 /src/Core/Localization/Number/Formatter.php
662 /override/classes/Cart.php
663 /classes/Cart.php
664 /src/Adapter/AddressFactory.php
665 /override/classes/CartRule.php
666 /classes/CartRule.php
667 /classes/Product.php
668 /src/Core/Domain/Product/ValueObject/RedirectType.php
669 /src/Core/Util/DateTime/DateTime.php
670 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
671 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
672 /src/Core/Domain/Product/ValueObject/ProductType.php
673 /src/Core/Domain/Product/ValueObject/Reference.php
674 /src/Core/Domain/Product/ValueObject/Ean13.php
675 /src/Core/Domain/Product/ValueObject/Isbn.php
676 /src/Core/Domain/Product/ValueObject/Upc.php
677 /src/Core/Domain/Product/ProductSettings.php
678 /src/Core/Domain/Shop/ValueObject/ShopId.php
679 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
680 /modules/ps_emailsubscription/ps_emailsubscription.php
681 /src/Core/Module/WidgetInterface.php
682 /src/PrestaShopBundle/Translation/DomainNormalizer.php
683 /classes/Media.php
684 /modules/ps_emailalerts/ps_emailalerts.php
685 /modules/ps_emailalerts/MailAlert.php
686 /modules/iqitproductvariants/iqitproductvariants.php
687 /src/Adapter/Localization/LegacyTranslator.php
688 /src/Adapter/Presenter/Cart/CartLazyArray.php
689 /src/Adapter/Presenter/AbstractLazyArray.php
690 /src/Adapter/Product/PriceFormatter.php
691 /src/Core/Util/Inflector.php
692 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
693 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
694 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
695 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
696 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
697 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
698 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
699 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
700 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
701 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
702 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
703 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
704 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
705 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
706 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
707 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
708 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
709 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
710 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
711 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
712 /classes/Gender.php
713 /classes/Risk.php
714 /classes/Meta.php
715 /modules/revsliderprestashop/revsliderprestashop.php
716 /modules/revsliderprestashop/rev-loader.php
717 /modules/revsliderprestashop/includes/revslider_db.class.php
718 /modules/revsliderprestashop/includes/data.class.php
719 /modules/revsliderprestashop/includes/functions.class.php
720 /modules/revsliderprestashop/includes/em-integration.class.php
721 /modules/revsliderprestashop/includes/cssparser.class.php
722 /modules/revsliderprestashop/includes/woocommerce.class.php
723 /modules/revsliderprestashop/includes/wpml.class.php
724 /modules/revsliderprestashop/includes/colorpicker.class.php
725 /modules/revsliderprestashop/includes/navigation.class.php
726 /modules/revsliderprestashop/includes/object-library.class.php
727 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
728 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
729 /modules/revsliderprestashop/includes/extension.class.php
730 /modules/revsliderprestashop/includes/favorite.class.php
731 /modules/revsliderprestashop/includes/aq-resizer.class.php
732 /modules/revsliderprestashop/includes/external-sources.class.php
733 /modules/revsliderprestashop/includes/page-template.class.php
734 /modules/revsliderprestashop/includes/slider.class.php
735 /modules/revsliderprestashop/includes/slide.class.php
736 /modules/revsliderprestashop/includes/output.class.php
737 /modules/revsliderprestashop/public/revslider-front.class.php
738 /modules/revsliderprestashop/includes/backwards.php
739 /modules/revsliderprestashop/admin/includes/class-pclzip.php
740 /modules/revsliderprestashop/admin/includes/license.class.php
741 /modules/revsliderprestashop/admin/includes/addons.class.php
742 /modules/revsliderprestashop/admin/includes/template.class.php
743 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
744 /modules/revsliderprestashop/admin/includes/folder.class.php
745 /modules/revsliderprestashop/admin/includes/import.class.php
746 /modules/revsliderprestashop/admin/includes/export.class.php
747 /modules/revsliderprestashop/admin/includes/export-html.class.php
748 /modules/revsliderprestashop/admin/includes/newsletter.class.php
749 /modules/revsliderprestashop/admin/revslider-admin.class.php
750 /modules/revsliderprestashop/includes/update.class.php
751 /modules/revsliderprestashop/includes/resize-imag.php
752 /modules/revsliderprestashop/translations/es.php
753 /classes/Address.php
754 /classes/ImageType.php
755 /classes/State.php
756 /src/Core/Security/PasswordPolicyConfiguration.php
757 /src/Core/Configuration/DataConfigurationInterface.php
758 /src/Core/Filter/FrontEndObject/MainFilter.php
759 /src/Core/Filter/FilterInterface.php
760 /src/Core/Filter/FrontEndObject/CartFilter.php
761 /src/Core/Filter/HashMapWhitelistFilter.php
762 /src/Core/Filter/CollectionFilter.php
763 /src/Core/Filter/FrontEndObject/ProductFilter.php
764 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
765 /src/Core/Filter/FrontEndObject/CustomerFilter.php
766 /src/Core/Filter/FrontEndObject/ShopFilter.php
767 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
768 /modules/productcomments/productcomments.php
769 /modules/ps_shoppingcart/ps_shoppingcart.php
770 /modules/iqitcontactpage/iqitcontactpage.php
771 /modules/iqitcontactpage/translations/es.php
772 /modules/iqitcookielaw/iqitcookielaw.php
773 /modules/iqitcookielaw/translations/es.php
774 /modules/iqitcountdown/iqitcountdown.php
775 /modules/iqitcountdown/translations/es.php
776 /modules/iqitsociallogin/iqitsociallogin.php
777 /modules/iqitsociallogin/translations/es.php
778 /modules/ps_googleanalytics/ps_googleanalytics.php
779 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
780 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
781 /classes/Smarty/SmartyDevTemplate.php
782 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
783 /var/cache/dev/smarty/compile/warehouse/7f/93/a7/7f93a70bcc26a0e15d5a8f0ad7b21b4b42ad15c2_2.file.ps_googleanalytics.tpl.php
784 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
785 /classes/assets/PrestashopAssetsLibraries.php
786 /modules/iqitsizecharts/iqitsizecharts.php
787 /modules/iqitsizecharts/src/IqitSizeCharts.php
788 /modules/iqitsizecharts/translations/es.php
789 /modules/iqitwishlist/iqitwishlist.php
790 /modules/iqitwishlist/src/IqitWishlistProduct.php
791 /modules/iqitwishlist/translations/es.php
792 /modules/iqitreviews/iqitreviews.php
793 /modules/iqitreviews/src/IqitProductReview.php
794 /modules/iqitreviews/translations/es.php
795 /modules/iqitpopup/iqitpopup.php
796 /modules/iqitpopup/translations/es.php
797 /modules/iqitmegamenu/iqitmegamenu.php
798 /modules/iqitmegamenu/models/IqitMenuTab.php
799 /modules/iqitmegamenu/models/IqitMenuHtml.php
800 /modules/iqitmegamenu/models/IqitMenuLinks.php
801 /modules/iqitmegamenu/translations/es.php
802 /modules/iqitcompare/iqitcompare.php
803 /modules/iqitcompare/translations/es.php
804 /modules/iqitelementor/iqitelementor.php
805 /modules/iqitelementor/src/IqitElementorLanding.php
806 /modules/iqitelementor/src/IqitElementorTemplate.php
807 /modules/iqitelementor/src/IqitElementorProduct.php
808 /modules/iqitelementor/src/IqitElementorCategory.php
809 /modules/iqitelementor/src/IqitElementorContent.php
810 /modules/iqitelementor/src/iqitElementorWpHelper.php
811 /modules/iqitelementor/includes/plugin-elementor.php
812 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
813 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
814 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
815 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
816 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
817 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
818 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
819 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
820 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
821 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
822 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
823 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
824 /modules/iqitelementor/translations/es.php
825 /modules/iqitextendedproduct/iqitextendedproduct.php
826 /modules/iqitextendedproduct/src/IqitThreeSixty.php
827 /modules/iqitextendedproduct/src/IqitProductVideo.php
828 /modules/iqitextendedproduct/translations/es.php
829 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
830 /modules/iqitfreedeliverycount/translations/es.php
831 /src/Core/Product/Search/ProductSearchContext.php
832 /src/Core/Product/Search/ProductSearchQuery.php
833 /src/Core/Product/Search/SortOrder.php
834 /modules/ps_facetedsearch/ps_facetedsearch.php
835 /modules/ps_facetedsearch/src/HookDispatcher.php
836 /modules/ps_facetedsearch/src/Hook/Attribute.php
837 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
838 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
839 /modules/ps_facetedsearch/src/Hook/Category.php
840 /modules/ps_facetedsearch/src/Hook/Configuration.php
841 /modules/ps_facetedsearch/src/Hook/Design.php
842 /modules/ps_facetedsearch/src/Hook/Feature.php
843 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
844 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
845 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
846 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
847 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
848 /modules/ps_facetedsearch/src/Hook/Product.php
849 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
850 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
851 /modules/ps_facetedsearch/src/Filters/Provider.php
852 /modules/ps_facetedsearch/src/URLSerializer.php
853 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
854 /modules/ps_facetedsearch/src/Product/SearchProvider.php
855 /src/Core/Product/Search/FacetsRendererInterface.php
856 /src/Core/Product/Search/ProductSearchProviderInterface.php
857 /modules/ps_facetedsearch/src/Filters/Converter.php
858 /modules/ps_facetedsearch/src/Product/SearchFactory.php
859 /src/Core/Product/Search/ProductSearchResult.php
860 /classes/Combination.php
861 /classes/Manufacturer.php
862 /src/Core/Util/String/StringModifier.php
863 /src/Core/Util/String/StringModifierInterface.php
864 /modules/ps_facetedsearch/src/Product/Search.php
865 /modules/ps_facetedsearch/src/Adapter/MySQL.php
866 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
867 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
868 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
869 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
870 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
871 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
872 /modules/ps_facetedsearch/src/Filters/Products.php
873 /classes/stock/StockAvailable.php
874 /modules/ps_facetedsearch/src/Filters/Block.php
875 /src/Core/Product/Search/Facet.php
876 /src/Core/Product/Search/Filter.php
877 /vendor/prestashop/decimal/src/DecimalNumber.php
878 /vendor/prestashop/decimal/src/Builder.php
879 /src/Core/Product/Search/FacetCollection.php
880 /classes/ProductAssembler.php
881 /classes/tax/Tax.php
882 /classes/SpecificPrice.php
883 /classes/tax/TaxManagerFactory.php
884 /classes/tax/TaxRulesTaxManager.php
885 /classes/tax/TaxManagerInterface.php
886 /classes/tax/TaxCalculator.php
887 /classes/GroupReduction.php
888 /src/Core/Localization/CLDR/ComputingPrecision.php
889 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
890 /classes/Pack.php
891 /classes/order/Order.php
892 /classes/Feature.php
893 /classes/ProductPresenterFactory.php
894 /src/Adapter/Presenter/Product/ProductListingPresenter.php
895 /src/Adapter/Presenter/Product/ProductPresenter.php
896 /src/Adapter/Product/ProductColorsRetriever.php
897 /src/Adapter/HookManager.php
898 /src/Core/Product/ProductPresentationSettings.php
899 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
900 /src/Adapter/Presenter/Product/ProductLazyArray.php
901 /classes/Image.php
902 /src/Core/Image/ImageFormatConfiguration.php
903 /src/Core/Image/ImageFormatConfigurationInterface.php
904 /classes/FeatureFlag.php
905 /src/Core/FeatureFlag/FeatureFlagSettings.php
906 /classes/ImageManager.php
907 /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
908 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
909 /vendor/smarty/smarty/libs/plugins/modifier.count.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
912 /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
913 /src/Core/Product/Search/Pagination.php
914 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/a2/ac/10a2acb40a62faa7d4acf2ff79326cb9143364b9_2.file.category.tpl.php
915 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
916 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/7b/44/3b7b442e5be09f725564779ed89a7b73454120cc_2.file.product-list.tpl.php
917 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7b/05/e6/7b05e63eca4eeeca1407af0182fcc5f72eca6296_2.file.layout-left-column.tpl.php
918 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/dd/6f/fedd6f2f1c5383ca8f7a88001e645ec51798686f_2.file.layout-both-columns.tpl.php
919 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9f/7e/4a/9f7e4a2a31953c1ffd9af92c83bd91c1f3cd2c35_2.file.helpers.tpl.php
920 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
921 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/44/bf/b0/44bfb034c1f795379c422b7f1f9e16fbdd438c93_2.file.head.tpl.php
922 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/74/6f/a3/746fa3dd2b21e5f8274bb1f50aedff4595bb552e_2.file.head-jsonld.tpl.php
923 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/8d/80/d08d80bb870efd73dd55124817cbf5d770e7f7b2_2.file.product-list-jsonld.tpl.php
924 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/56/86/bf/5686bf9c07020fd395790a361d8976132a2fc4be_2.file.pagination-seo.tpl.php
925 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
926 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/93/e8/ed/93e8edeadb416f4f6abcf2d2b76fb0f54d0eba3d_2.file.stylesheets.tpl.php
927 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/af/76/c2af76b01726147ed1ded7543d0fd920339756bf_2.file.javascript.tpl.php
928 /classes/ProductDownload.php
929 /src/Core/Cart/Calculator.php
930 /src/Core/Cart/CartRowCollection.php
931 /src/Core/Cart/Fees.php
932 /src/Core/Cart/AmountImmutable.php
933 /src/Core/Cart/CartRuleCollection.php
934 /src/Core/Cart/CartRuleCalculator.php
935 /src/Adapter/Product/PriceCalculator.php
936 /src/Core/Cart/CartRow.php
937 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
938 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/0d/00/3b0d00bced40dc74d264c896b3629516dca0a06b_2.file.product-activation.tpl.php
939 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/2a/1d/d02a1d5aa2fc8a2b372e76425c1d49b597137881_2.file.header.tpl.php
940 /modules/iqitlinksmanager/iqitlinksmanager.php
941 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
942 /modules/iqitlinksmanager/src/IqitLinkBlock.php
943 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
944 /modules/iqitlinksmanager/translations/es.php
945 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
946 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
947 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
948 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
949 /modules/ps_languageselector/ps_languageselector.php
950 /modules/ps_currencyselector/ps_currencyselector.php
951 /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
952 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/54/66/f65466132945e631eb8304d318e35f83d75d651e_2.file.header-2.tpl.php
953 /modules/iqitsearch/iqitsearch.php
954 /modules/iqitsearch/translations/es.php
955 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
956 /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
957 /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
958 /modules/ps_customersignin/ps_customersignin.php
959 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
960 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
961 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
962 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
963 /var/cache/dev/smarty/compile/warehouse/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
964 /var/cache/dev/smarty/compile/warehouse/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
965 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/a0/a9/c9/a0a9c936f74308bdc1809002e948b8c26b0f5101.iqitmegamenuviewstemplateshookhorizontal.tpl.php
966 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/32/0c/d5/320cd56ae00cdb0df3cfaafda14dd79eef879159_2.file.mobile-header-2.tpl.php
967 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
968 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
969 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
970 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/88/01/f3/8801f3aef6612da9973e6f09844670ad2455b33c_2.file.breadcrumb.tpl.php
971 /modules/iqitproductsnav/iqitproductsnav.php
972 /modules/iqitproductsnav/translations/es.php
973 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/50/cf/2150cf9c7d24917c3322283d8d2a9798a55f33e1_2.file.notifications.tpl.php
974 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/39/dd/35/39dd3579b0d411714a13183f74f90657d9b16218_2.file.category-header.tpl.php
975 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/dc/dd/42/dcdd424ea5bdc2c731edea74e82e1b9752018d7f_2.file.products-top.tpl.php
976 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
977 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/f8/f7/e0f8f73bf2628e2a1784900d2234f9911a72566f_2.file.sort-orders.tpl.php
978 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/01/2d/6a/012d6af2272aef31c4959b70cb660dbba790eea4_2.file.pagination.tpl.php
979 /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
980 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e1/47/0e/e1470e491391572ac54700f0cafe332fed74977f_2.file.products.tpl.php
981 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/df/f3/21dff30aa3f82bc080b677e35ebedc1ec9a53690_2.file.product.tpl.php
982 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b2/b6/ab/b2b6ab658128da2281b45debedef04ba4285e0d8_2.file.product-miniature-1.tpl.php
983 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/70/ad/8b/70ad8bf895d617e9f5f73f4ce8c2c56d5c17c215_2.file.product-miniature-thumb.tpl.php
984 /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
985 /var/cache/dev/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
986 /modules/iqitproductflags/iqitproductflags.php
987 /src/Adapter/ContainerFinder.php
988 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php
989 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php
990 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php
991 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php
992 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php
993 /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php
994 /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php
995 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php
996 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php
997 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php
998 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php
999 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php
1000 /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php
1001 /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php
1002 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php
1003 /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php
1004 /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php
1005 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php
1006 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php
1007 /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php
1008 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php
1009 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php
1010 /vendor/doctrine/persistence/src/Persistence/ObjectManager.php
1011 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php
1012 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php
1013 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php
1014 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php
1015 /vendor/doctrine/doctrine-bundle/ConnectionFactory.php
1016 /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php
1017 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php
1018 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php
1019 /vendor/doctrine/event-manager/src/EventManager.php
1020 /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php
1021 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php
1022 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php
1023 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php
1024 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php
1025 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php
1026 /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php
1027 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php
1028 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php
1029 /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php
1030 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php
1031 /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php
1032 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php
1033 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php
1034 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php
1035 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php
1036 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php
1037 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php
1038 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php
1039 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php
1040 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php
1041 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php
1042 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php
1043 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php
1044 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL80Platform.php
1045 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL57Platform.php
1046 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php
1047 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php
1048 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php
1049 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php
1050 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php
1051 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php
1052 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php
1053 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php
1054 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php
1055 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php
1056 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php
1057 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php
1058 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php
1059 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php
1060 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php
1061 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php
1062 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php
1063 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php
1064 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php
1065 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php
1066 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php
1067 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php
1068 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php
1069 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php
1070 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php
1071 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php
1072 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php
1073 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php
1074 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php
1075 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php
1076 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php
1077 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php
1078 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php
1079 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php
1080 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php
1081 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php
1082 /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php
1083 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php
1084 /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php
1085 /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php
1086 /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php
1087 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php
1088 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php
1089 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php
1090 /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php
1091 /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php
1092 /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php
1093 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php
1094 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php
1095 /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php
1096 /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php
1097 /vendor/doctrine/persistence/src/Persistence/Proxy.php
1098 /modules/iqitproductflags/src/Entity/IqitProductFlag.php
1099 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php
1100 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php
1101 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php
1102 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php
1103 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php
1104 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php
1105 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php
1106 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php
1107 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php
1108 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php
1109 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php
1110 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php
1111 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php
1112 /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php
1113 /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php
1114 /src/PrestaShopBundle/Entity/Shop.php
1115 /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php
1116 /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php
1117 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php
1118 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php
1119 /modules/iqitproductflags/src/Repository/FlagRepository.php
1120 /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php
1121 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php
1122 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php
1123 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php
1124 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php
1125 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php
1126 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php
1127 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php
1128 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php
1129 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php
1130 /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php
1131 /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php
1132 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php
1133 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php
1134 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php
1135 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php
1136 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php
1137 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php
1138 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php
1139 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php
1140 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php
1141 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php
1142 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php
1143 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php
1144 /src/PrestaShopBundle/Entity/Lang.php
1145 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php
1146 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php
1147 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php
1148 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php
1149 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php
1150 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php
1151 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php
1152 /src/PrestaShopBundle/Entity/ShopGroup.php
1153 /src/PrestaShopBundle/Entity/ShopUrl.php
1154 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php
1155 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php
1156 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php
1157 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php
1158 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php
1159 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php
1160 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php
1161 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php
1162 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php
1163 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php
1164 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php
1165 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php
1166 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php
1167 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php
1168 /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php
1169 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php
1170 /src/PrestaShopBundle/Entity/Translation.php
1171 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php
1172 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php
1173 /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php
1174 /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php
1175 /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php
1176 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php
1177 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php
1178 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php
1179 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php
1180 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php
1181 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php
1182 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php
1183 /modules/iqitproductflags/src/Presenter/FlagPresenter.php
1184 /var/cache/dev/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php
1185 /var/cache/dev/smarty/compile/warehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1186 /vendor/smarty/smarty/libs/plugins/function.math.php
1187 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/75/b9/97/75b997bec85704ff1d7a8fb47417253a50e7be32_2.file.product-miniature-btn.tpl.php
1188 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/50/d2/88/50d288732d70e59ef94f3875a561157d73c09f9e_2.file.products-bottom.tpl.php
1189 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/ce/84/ea/ce84eadc655e6b98707bc940129b94e0b7569370_2.file.category-footer.tpl.php
1190 /modules/ps_categorytree/ps_categorytree.php
1191 /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1192 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/3a/47/3e3a47dc2c5a5d8e5e109d269aa58f1349bf3548_2.file.footer.tpl.php
1193 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e6/9f/81/e69f8156b2319dff0e9edb2994d7f3cbefe774c5_2.file.footer-2.tpl.php
1194 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1195 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/6/warehouse/1d/83/01/1d8301bd7699d773c48e9ed487e5b638a51c9c67.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1196 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/00/82/b5/0082b5f5ed9b849deb993e6b9ea0688ca3375d26_2.file.footer-copyrights-1.tpl.php
1197 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e7/73/6b/e7736b26e5e94f428f828dbc3573ce171a95c436_2.file.password-policy-template.tpl.php
1198 /classes/form/CustomerLoginForm.php
1199 /classes/form/AbstractForm.php
1200 /classes/form/FormInterface.php
1201 /src/Core/Foundation/Templating/RenderableInterface.php
1202 /classes/form/CustomerLoginFormatter.php
1203 /classes/form/FormFormatterInterface.php
1204 /classes/ValidateConstraintTranslator.php
1205 /src/Core/Util/InternationalizedDomainNameConverter.php
1206 /src/Core/Foundation/Templating/RenderableProxy.php
1207 /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1208 /classes/form/FormField.php
1209 /var/cache/dev/smarty/compile/warehouse/f2/1e/55/f21e55894ac1dca3333e5ff490219e193d3a69c6_2.file.login-form.tpl.php
1210 /var/cache/dev/smarty/compile/warehouse/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1211 /var/cache/dev/smarty/compile/d2/95/88/d29588162f18c1514f5b17d42ceef7eee6820be1_2.file.form-fields.tpl.php
1212 /var/cache/dev/smarty/compile/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1213 /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/6/warehouse/60/1e/f4/601ef4a2f7dca2c97f8f1a899dc64be4a2331ab8.iqitsocialloginviewstemplateshookauthentication.tpl.php
1214 /var/cache/dev/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1215 /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/02/05/98/020598f14f8b3a756a608f01492a41ebd60e5afd.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1216 /modules/statsdata/statsdata.php
1217 /classes/Connection.php
1218 /classes/ConnectionsSource.php
1219 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1220 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1221 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1222 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1223 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1224 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1225 /var/cache/dev/smarty/compile/warehouse/0b/04/d5/0b04d5d296cc40e94fc50a82355434090632a0d7_2.file.ga_tag.tpl.php