Carrito
FACIAL
Filtros activos
| Load Time | 368.745 ms |
| Querying Time | 100 ms |
| Queries | 171 |
| Memory Peak Usage | 52.6 Mb |
| Included Files | 1225 files - 12.67 Mb |
| PrestaShop Cache | - Mb |
| Global vars | 0.04 Mb |
| PrestaShop Version | 8.2.7 |
| PHP Version | 8.4.10 |
| MySQL Version | 8.0.45-36 |
| Memory Limit | 512M |
| Max Execution Time | 165s |
| Smarty Cache | enabled |
| Smarty Compilation | never recompile |
| Time | Cumulated Time | Memory Usage | Memory Peak Usage | |
|---|---|---|---|---|
| config | 123.907 ms | 123.907 ms | 18.40 Mb | 19.6 Mb |
| __construct | 0.011 ms | 123.918 ms | - Mb | 19.6 Mb |
| init | 35.829 ms | 159.747 ms | 5.29 Mb | 24.7 Mb |
| checkAccess | 0.002 ms | 159.749 ms | - Mb | 24.7 Mb |
| setMedia | 4.332 ms | 164.081 ms | 0.79 Mb | 24.7 Mb |
| postProcess | 0.001 ms | 164.082 ms | - Mb | 24.7 Mb |
| initHeader | 0.001 ms | 164.083 ms | - Mb | 24.7 Mb |
| initContent | 109.872 ms | 273.955 ms | 17.20 Mb | 41.7 Mb |
| initFooter | 0.002 ms | 273.957 ms | - Mb | 41.7 Mb |
| display | 94.788 ms | 368.745 ms | 10.47 Mb | 52.6 Mb |
| Hook | Time | Memory Usage |
|---|---|---|
| DisplayProductCampagains | 41.009 ms | 5.24 Mb |
| displayLeftColumn | 6.860 ms | 0.23 Mb |
| displayBeforeBodyClosingTag | 6.639 ms | 0.81 Mb |
| DisplayBeforeBodyClosingTag | 6.527 ms | 0.33 Mb |
| displayProductListReviews | 2.739 ms | 0.14 Mb |
| displayNav2 | 2.716 ms | 0.18 Mb |
| DisplayHeader | 2.570 ms | 0.18 Mb |
| displayCategoryElementor | 2.047 ms | 0.08 Mb |
| renderWidget | 1.853 ms | 0.15 Mb |
| displayNav1 | 1.697 ms | 0.15 Mb |
| displayFooter | 1.682 ms | 0.10 Mb |
| displayCustomerLoginFormAfter | 1.440 ms | 0.07 Mb |
| ProductSearchProvider | 1.151 ms | 0.20 Mb |
| displayTop | 1.008 ms | 0.12 Mb |
| displayMainMenu | 0.922 ms | 0.20 Mb |
| ActionFrontControllerSetMedia | 0.731 ms | 0.13 Mb |
| displayAfterBreadcrumb | 0.690 ms | 0.04 Mb |
| IsJustElementor | 0.441 ms | 0.02 Mb |
| displayProductListFunctionalButtons | 0.341 ms | 0.02 Mb |
| DisplayLeftColumn | 0.215 ms | 0.03 Mb |
| OverrideLayoutTemplate | 0.032 ms | - Mb |
| displayVerticalMenu | 0.009 ms | - Mb |
| ModuleRoutes | 0.007 ms | - Mb |
| ActionDispatcher | 0.005 ms | - Mb |
| ActionProductSearchAfter | 0.005 ms | - Mb |
| 25 hook(s) | 83.336 ms | 8.41 Mb |
| Module | Time | Memory Usage |
|---|---|---|
| ph_simpleblog | 23.685 ms | 3.30 Mb |
| iqitthemeeditor | 2.900 ms | 0.54 Mb |
| ps_emailsubscription | 1.846 ms | 0.37 Mb |
| ps_emailalerts | 1.260 ms | 0.29 Mb |
| iqitproductvariants | 0.805 ms | 0.04 Mb |
| revsliderprestashop | 32.433 ms | 7.98 Mb |
| productcomments | 0.835 ms | 0.28 Mb |
| ps_shoppingcart | 1.250 ms | 0.17 Mb |
| iqitcontactpage | 1.710 ms | 0.12 Mb |
| iqitcookielaw | 1.467 ms | 0.11 Mb |
| iqitcountdown | 0.250 ms | 0.03 Mb |
| iqitsociallogin | 2.315 ms | 0.14 Mb |
| ps_googleanalytics | 3.993 ms | 0.36 Mb |
| iqitsizecharts | 1.914 ms | 0.26 Mb |
| iqitwishlist | 6.302 ms | 0.89 Mb |
| iqitreviews | 3.172 ms | 0.24 Mb |
| iqitpopup | 1.409 ms | 0.15 Mb |
| iqitmegamenu | 3.963 ms | 1.06 Mb |
| iqitcompare | 1.263 ms | 0.12 Mb |
| iqitelementor | 6.326 ms | 1.07 Mb |
| iqitextendedproduct | 0.706 ms | 0.16 Mb |
| iqitfreedeliverycount | 0.315 ms | 0.06 Mb |
| ps_facetedsearch | 4.460 ms | 0.82 Mb |
| iqitlinksmanager | 2.717 ms | 0.31 Mb |
| ps_languageselector | 0.843 ms | 0.13 Mb |
| ps_currencyselector | 0.767 ms | 0.07 Mb |
| iqitsearch | 1.352 ms | 0.12 Mb |
| ps_customersignin | 0.131 ms | 0.03 Mb |
| iqitproductsnav | 0.909 ms | 0.07 Mb |
| iqitproductflags | 41.326 ms | 5.36 Mb |
| ps_categorytree | 7.348 ms | 0.29 Mb |
| statsdata | 4.009 ms | 0.16 Mb |
| 32 module(s) | 163.981 ms | 25.12 Mb |
| # | Query | Time (ms) | Rows | Filesort | Group By | Location |
|---|---|---|---|---|---|---|
| 3 | SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop FROM `och438configuration` c LEFT JOIN `och438configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`) |
7.174 ms | 1327 | /classes/Configuration.php:180 | ||
| 14 | SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module FROM `och438module` m INNER JOIN och438module_shop module_shop ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1) INNER JOIN `och438hook_module` `hm` ON hm.`id_module` = m.`id_module` INNER JOIN `och438hook` `h` ON hm.`id_hook` = h.`id_hook` LEFT JOIN `och438module_group` `mg` ON mg.`id_module` = m.`id_module` WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND mg.`id_group` IN (1)) GROUP BY hm.id_hook, hm.id_module ORDER BY hm.`position` |
2.993 ms | 1560 | Yes | Yes | /classes/Hook.php:1289 |
| 91 | REPLACE INTO och438layered_filter_block (hash, data) VALUES ("ba08a8244b89a2a1773701496f99615f", "a:1:{s:7:\"filters\";a:4:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:11:{i:26;a:2:{s:4:\"name\";s:11:\"LIMPIADORES\";s:3:\"nbr\";s:1:\"4\";}i:29;a:2:{s:4:\"name\";s:5:\"SERUM\";s:3:\"nbr\";s:2:\"16\";}i:33;a:2:{s:4:\"name\";s:16:\"CONTORNO DE OJOS\";s:3:\"nbr\";s:1:\"1\";}i:40;a:3:{s:4:\"name\";s:11:\"EXFOLIANTES\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:41;a:2:{s:4:\"name\";s:11:\"MASCARILLAS\";s:3:\"nbr\";s:1:\"4\";}i:42;a:2:{s:4:\"name\";s:8:\"TÓNICOS\";s:3:\"nbr\";s:1:\"5\";}i:44;a:2:{s:4:\"name\";s:6:\"CREMAS\";s:3:\"nbr\";s:2:\"10\";}i:94;a:2:{s:4:\"name\";s:11:\"MAQUILLAJES\";s:3:\"nbr\";s:1:\"5\";}i:130;a:2:{s:4:\"name\";s:17:\"COSMETICA COREANA\";s:3:\"nbr\";s:2:\"22\";}i:131;a:2:{s:4:\"name\";s:16:\"POTENCIA TU GLOW\";s:3:\"nbr\";s:2:\"12\";}i:138;a:2:{s:4:\"name\";s:7:\"MANCHAS\";s:3:\"nbr\";s:1:\"3\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:8:{i:12;a:2:{s:4:\"name\";s:11:\"IFCANTABRIA\";s:3:\"nbr\";s:1:\"3\";}i:13;a:2:{s:4:\"name\";s:15:\"LAB SVR ESPAÑA\";s:3:\"nbr\";s:1:\"2\";}i:57;a:2:{s:4:\"name\";s:11:\"ARTURO ALBA\";s:3:\"nbr\";s:1:\"2\";}i:68;a:2:{s:4:\"name\";s:18:\"GEMA HERRERIA S.LU\";s:3:\"nbr\";s:1:\"4\";}i:93;a:2:{s:4:\"name\";s:16:\"BEAUTY OF JOSEON\";s:3:\"nbr\";s:1:\"1\";}i:94;a:3:{s:4:\"name\";s:6:\"TOCOBO\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:115;a:2:{s:4:\"name\";s:8:\"MEDICUBE\";s:3:\"nbr\";s:1:\"1\";}i:125;a:2:{s:4:\"name\";s:4:\"ANUA\";s:3:\"nbr\";s:1:\"1\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:21;s:3:\"min\";d:20;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:1;s:5:\"value\";N;}i:3;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Selecciones\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:9:\"En oferta\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:5:\"Nuevo\";s:3:\"nbr\";i:0;}s:8:\"discount\";a:2:{s:4:\"name\";s:13:\"Con descuento\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}") |
2.732 ms | 1 | /modules/ps_facetedsearch/src/Filters/Block.php:210 | ||
| 168 | INSERT INTO `och438connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('199835', '', 'farmacialanueva.online/22-facial?q=Marca-BIOCOSMETICS-d%27Alba-SKINCEUTICALS-TIRTIR-TOCOBO-VT+COSMETICS%2FCategor%C3%ADas-EXFOLIANTES', '', '2026-06-22 20:09:39') |
2.479 ms | 1 | /classes/ObjectModel.php:622 | ||
| 13 | SELECT SQL_NO_CACHE lower(name) as name FROM `och438hook` h WHERE (h.active = 1) |
2.207 ms | 1143 | /classes/Hook.php:1388 | ||
| 74 | SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=3 AND c.nleft>7 AND c.nright<40 GROUP BY cp.id_category |
2.185 ms | 1220 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 16 | SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook` |
1.934 ms | 1143 | /classes/Hook.php:1348 | ||
| 101 | SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook` UNION SELECT `id_hook`, ha.`alias` as name FROM `och438hook_alias` ha INNER JOIN `och438hook` h ON ha.name = h.name |
1.564 ms | 0 | /classes/Hook.php:1348 | ||
| 153 | SELECT SQL_NO_CACHE c.*, cl.* FROM `och438category` c INNER JOIN och438category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 LEFT JOIN `och438category_group` cg ON c.`id_category` = cg.`id_category` RIGHT JOIN `och438category` c2 ON c2.`id_category` = 22 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright` WHERE 1 AND c.`level_depth` <= 6 AND `id_lang` = 1 AND c.`active` = 1 AND cg.`id_group` IN (1) GROUP BY c.`id_category` ORDER BY c.`level_depth` ASC, category_shop.`position` ASC |
1.473 ms | 61 | Yes | Yes | /classes/Category.php:785 |
| 102 | SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active FROM `och438hook_module` hm STRAIGHT_JOIN `och438hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1) STRAIGHT_JOIN `och438module` as m ON (m.id_module = hm.id_module) ORDER BY hm.position |
1.429 ms | 524 | /classes/Hook.php:455 | ||
| 12 | SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `och438lang` l JOIN och438lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1) WHERE l.`active` = 1 LIMIT 1 |
1.089 ms | 1 | /classes/Language.php:1214 | ||
| 170 | SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `och438category_product` cp LEFT JOIN `och438category` c ON (c.id_category = cp.id_category) LEFT JOIN `och438category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 ) INNER JOIN och438category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) WHERE cp.`id_product` IN (2208) AND cl.`id_lang` = 1 ORDER BY c.`level_depth` DESC |
1.068 ms | 61 | Yes | /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:103 | |
| 144 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitreviews" LIMIT 1 |
0.996 ms | 1 | /classes/module/Module.php:2664 | ||
| 22 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `och438module` m LEFT JOIN `och438module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.918 ms | 104 | /classes/module/Module.php:341 | ||
| 147 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `och438product_attribute` pa INNER JOIN och438product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (2208) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` ORDER BY a.`position` ASC; |
0.869 ms | 1 | Yes | Yes | /classes/Product.php:4513 |
| 20 | SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang FROM `och438meta` m LEFT JOIN `och438meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 ) ORDER BY LENGTH(ml.url_rewrite) DESC |
0.854 ms | 57 | Yes | /classes/Dispatcher.php:654 | |
| 154 | SELECT SQL_NO_CACHE DISTINCT c.* FROM `och438category` c LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1) WHERE `level_depth` = 1 |
0.789 ms | 1 | /classes/Category.php:2239 | ||
| 71 | SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC |
0.766 ms | 64 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 90 | SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p LEFT JOIN och438specific_price sp ON (
sp.id_product = p.id_product AND
sp.id_shop IN (0, 1) AND
sp.id_currency IN (0, 1) AND
sp.id_country IN (0, 6) AND
sp.id_group IN (0, 1) AND
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND
(sp.from = '0000-00-00 00:00:00' OR '2026-06-22 20:09:38' >= sp.from) AND
(sp.to = '0000-00-00 00:00:00' OR '2026-06-22 20:09:38' <= sp.to)
) WHERE ((sp.reduction>0)) |
0.764 ms | 32 | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | ||
| 70 | SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description` FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC |
0.748 ms | 129 | Yes | /classes/Manufacturer.php:201 | |
| 2 | SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri FROM och438shop_group gs LEFT JOIN och438shop s ON s.id_shop_group = gs.id_shop_group LEFT JOIN och438shop_url su ON s.id_shop = su.id_shop AND su.main = 1 WHERE s.deleted = 0 AND gs.deleted = 0 ORDER BY gs.name, s.name |
0.735 ms | 1 | Yes | /classes/shop/Shop.php:715 | |
| 54 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_legalcompliance" LIMIT 1 |
0.722 ms | 0 | /classes/module/Module.php:2664 | ||
| 158 | SELECT SQL_NO_CACHE c.*, cl.* FROM `och438category` c LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 121 ORDER BY `nleft` DESC |
0.714 ms | 4 | /classes/Category.php:1594 | ||
| 85 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute |
0.681 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 23 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 22) AND (b.`id_shop` = 1) LIMIT 1 |
0.672 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 81 | SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description` FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC |
0.672 ms | 129 | Yes | /classes/Manufacturer.php:201 | |
| 167 | SELECT SQL_NO_CACHE `id_guest` FROM `och438connections` WHERE `id_guest` = 200269 AND `date_add` > '2026-06-22 19:39:00' AND id_shop IN (1) ORDER BY `date_add` DESC LIMIT 1 |
0.667 ms | 1 | Yes | /classes/Connection.php:168 | |
| 82 | SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' GROUP BY p.id_product) p GROUP BY p.id_manufacturer |
0.664 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 1 | SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main FROM och438shop_url su LEFT JOIN och438shop s ON (s.id_shop = su.id_shop) WHERE (su.domain = 'farmacialanueva.online' OR su.domain_ssl = 'farmacialanueva.online') AND s.active = 1 AND s.deleted = 0 ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC |
0.657 ms | 1 | Yes | /classes/shop/Shop.php:1364 | |
| 76 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute |
0.649 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 19 | SELECT SQL_NO_CACHE name, alias FROM `och438hook_alias` |
0.634 ms | 88 | /classes/Hook.php:342 | ||
| 79 | SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value |
0.632 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 146 | SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb FROM `och438iqitreviews_products` pr WHERE pr.`status` = 1 AND pr.`id_product` = 2208 LIMIT 1 |
0.630 ms | 1 | /modules/iqitreviews/src/IqitProductReview.php:113 | ||
| 78 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute |
0.629 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 155 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1 |
0.614 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 11 | SELECT SQL_NO_CACHE domain, domain_ssl FROM och438shop_url WHERE main = 1 AND id_shop = 1 LIMIT 1 |
0.610 ms | 1 | /classes/shop/ShopUrl.php:178 | ||
| 89 | SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p WHERE p.date_add>'2026-06-03 00:00:00' |
0.605 ms | 32 | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | ||
| 7 | SELECT SQL_NO_CACHE * FROM `och438country` a LEFT JOIN `och438country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1 LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1 WHERE (a.`id_country` = 6) LIMIT 1 |
0.604 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 27 | SELECT SQL_NO_CACHE * FROM `och438currency` a LEFT JOIN `och438currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1 LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1 WHERE (a.`id_currency` = 1) LIMIT 1 |
0.597 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 87 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute |
0.592 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 37 | SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description` FROM `och438category` c INNER JOIN och438category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) LEFT JOIN `och438category_group` cg ON (cg.`id_category` = c.`id_category`) WHERE `id_parent` = 22 AND `active` = 1 AND cg.`id_group` =1 GROUP BY c.`id_category` ORDER BY `level_depth` ASC, category_shop.`position` ASC |
0.591 ms | 61 | Yes | Yes | /classes/Category.php:916 |
| 162 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1 |
0.590 ms | 1 | /classes/module/Module.php:2137 | ||
| 25 | SELECT SQL_NO_CACHE `id_lang` FROM `och438lang` WHERE `locale` = 'es-es' OR `language_code` = 'es-es' LIMIT 1 |
0.587 ms | 1 | /classes/Language.php:880 | ||
| 24 | SELECT SQL_NO_CACHE * FROM `och438currency` c ORDER BY `iso_code` ASC |
0.582 ms | 1 | Yes | /classes/Currency.php:708 | |
| 149 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1 |
0.581 ms | 1 | /classes/module/Module.php:2137 | ||
| 92 | SELECT SQL_NO_CACHE p.*, ps.*, pl.*, sa.out_of_stock, IFNULL(sa.quantity, 0) as quantity, (DATEDIFF( p.`date_add`, DATE_SUB( '2026-06-22 00:00:00', INTERVAL 20 DAY ) ) > 0) as new FROM och438product p LEFT JOIN och438product_lang pl ON pl.id_product = p.id_product AND pl.id_shop = 1 AND pl.id_lang = 1 LEFT JOIN och438stock_available sa ON sa.id_product = p.id_product AND sa.id_product_attribute = 0 AND sa.id_shop = 1 LEFT JOIN och438product_shop ps ON ps.id_product = p.id_product AND ps.id_shop = 1 WHERE p.id_product IN (2208) |
0.579 ms | 1 | /classes/ProductAssembler.php:95 | ||
| 161 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsociallogin" LIMIT 1 |
0.575 ms | 1 | /classes/module/Module.php:2664 | ||
| 6 | SELECT SQL_NO_CACHE l.*, ls.`id_shop` FROM `och438lang` l LEFT JOIN `och438lang_shop` ls ON (l.id_lang = ls.id_lang) |
0.573 ms | 1 | /classes/Language.php:1080 | ||
| 88 | SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p WHERE ((p.on_sale=1)) |
0.566 ms | 32 | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | ||
| 148 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitelementor" LIMIT 1 |
0.566 ms | 1 | /classes/module/Module.php:2664 | ||
| 17 | SELECT SQL_NO_CACHE value FROM `och438configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1 |
0.557 ms | 1 | /classes/shop/Shop.php:1183 | ||
| 110 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `och438cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 2208 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 2208 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.554 ms | 0 | /classes/Cart.php:1430 | ||
| 9 | SELECT SQL_NO_CACHE * FROM `och438lang` a LEFT JOIN `och438lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1 WHERE (a.`id_lang` = 1) LIMIT 1 |
0.553 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 169 | SELECT SQL_NO_CACHE data FROM `och438ganalytics_data` WHERE id_cart = 0 AND id_shop = 1 LIMIT 1 |
0.551 ms | 0 | /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:39 | ||
| 152 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1 |
0.546 ms | 1 | /classes/module/Module.php:2137 | ||
| 151 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_categorytree" LIMIT 1 |
0.545 ms | 1 | /classes/module/Module.php:2664 | ||
| 30 | SELECT SQL_NO_CACHE * FROM `och438currency_lang` WHERE `id_currency` = 1 |
0.543 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 77 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN och438attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC |
0.543 ms | 14 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 150 | SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c LEFT JOIN och438iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 22 AND s.id_shop = 1 LIMIT 1 |
0.543 ms | 1 | /modules/iqitelementor/src/IqitElementorCategory.php:87 | ||
| 15 | SELECT SQL_NO_CACHE `name`, `alias` FROM `och438hook_alias` |
0.539 ms | 88 | /classes/Hook.php:290 | ||
| 5 | SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl FROM och438shop s LEFT JOIN och438shop_url su ON (s.id_shop = su.id_shop) WHERE s.id_shop = 1 AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1 |
0.538 ms | 1 | /classes/shop/Shop.php:214 | ||
| 75 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN och438attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC |
0.538 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 80 | SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value |
0.538 ms | 32 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 156 | SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 22 LIMIT 1 |
0.537 ms | 1 | /classes/Category.php:1584 | ||
| 112 | SELECT SQL_NO_CACHE * FROM `och438product` a LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1 LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 2208) AND (b.`id_shop` = 1) LIMIT 1 |
0.532 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 159 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcontactpage" LIMIT 1 |
0.531 ms | 1 | /classes/module/Module.php:2664 | ||
| 0 | SELECT SQL_NO_CACHE * FROM och438memcached_servers |
0.528 ms | 1 | /classes/cache/CacheMemcached.php:263 | ||
| 73 | SELECT SQL_NO_CACHE c.`id_category`, cl.`name` FROM `och438category` c INNER JOIN och438category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 WHERE 1 AND `id_lang` = 1 AND c.`active` = 1 ORDER BY c.nleft, c.position |
0.524 ms | 61 | Yes | /classes/Category.php:710 | |
| 29 | SELECT SQL_NO_CACHE * FROM `och438currency` a LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1 WHERE (a.`id_currency` = 1) LIMIT 1 |
0.524 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 21 | SELECT SQL_NO_CACHE * FROM `och438hook_module_exceptions` WHERE `id_shop` IN (1) |
0.522 ms | 1 | /classes/module/Module.php:2046 | ||
| 26 | SELECT SQL_NO_CACHE c.id_currency FROM `och438currency` c WHERE (iso_code = 'EUR') LIMIT 1 |
0.520 ms | 1 | /classes/Currency.php:893 | ||
| 68 | SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `och438attribute_group` ag INNER JOIN och438attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `och438layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC |
0.511 ms | 4 | Yes | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122 |
| 157 | SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c WHERE c.`id_category` = 2 LIMIT 1 |
0.511 ms | 1 | /classes/Category.php:1589 | ||
| 8 | SELECT SQL_NO_CACHE * FROM `och438shop_group` a WHERE (a.`id_shop_group` = 1) LIMIT 1 |
0.508 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 83 | SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM och438product p INNER JOIN och438layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 6) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category='40' AND p.id_manufacturer IN (127, 112, 14, 119, 94, 126) |
0.501 ms | 16 | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | ||
| 4 | SELECT SQL_NO_CACHE * FROM `och438shop` a WHERE (a.`id_shop` = 1) LIMIT 1 |
0.491 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 28 | SELECT SQL_NO_CACHE `id_lang` FROM `och438lang` WHERE `locale` = 'es-es' OR `language_code` = 'es-es' LIMIT 1 |
0.488 ms | 1 | /classes/Language.php:880 | ||
| 69 | SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `och438feature` f INNER JOIN och438feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `och438feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `och438layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC |
0.485 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:159 | |
| 145 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 83 AND `id_shop` = 1 LIMIT 1 |
0.480 ms | 1 | /classes/module/Module.php:2137 | ||
| 160 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1 |
0.479 ms | 1 | /classes/module/Module.php:2137 | ||
| 84 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN och438attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC |
0.477 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 10 | SELECT SQL_NO_CACHE id_shop FROM `och438lang_shop` WHERE `id_lang` = 1 AND id_shop = 1 LIMIT 1 |
0.476 ms | 1 | /classes/ObjectModel.php:1727 | ||
| 18 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `och438module` m LEFT JOIN `och438module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.476 ms | 104 | /classes/module/Module.php:341 | ||
| 86 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN och438attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC |
0.474 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 119 | SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.472 ms | 13 | /classes/CartRule.php:357 | ||
| 165 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcookielaw" LIMIT 1 |
0.465 ms | 1 | /classes/module/Module.php:2664 | ||
| 163 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitpopup" LIMIT 1 |
0.462 ms | 1 | /classes/module/Module.php:2664 | ||
| 66 | SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM och438layered_category WHERE controller = 'category' AND id_category = 22 AND id_shop = 1 GROUP BY `type`, id_value ORDER BY position ASC |
0.459 ms | 10 | Yes | Yes | /modules/ps_facetedsearch/src/Filters/Provider.php:57 |
| 64 | SELECT SQL_NO_CACHE `name` FROM `och438hook` WHERE `id_hook` = 746 LIMIT 1 |
0.447 ms | 1 | /classes/Hook.php:244 | ||
| 67 | SELECT SQL_NO_CACHE c.*, cl.* FROM `och438category` c LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE `name` = 'EXFOLIANTES' AND c.`id_category` != 2 AND c.`id_parent` = 22 LIMIT 1 |
0.437 ms | 3 | /classes/Category.php:1492 | ||
| 166 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1 |
0.437 ms | 1 | /classes/module/Module.php:2137 | ||
| 164 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1 |
0.435 ms | 1 | /classes/module/Module.php:2137 | ||
| 63 | SELECT SQL_NO_CACHE * FROM och438revslider_sliders |
0.434 ms | 1 | /modules/revsliderprestashop/includes/revslider_db.class.php:214 | ||
| 118 | SELECT SQL_NO_CACHE 1 FROM och438cart_product cp INNER JOIN och438product p ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1 |
0.432 ms | 1 | /classes/Cart.php:4250 | ||
| 59 | SELECT SQL_NO_CACHE * FROM `och438country` a LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1 WHERE (a.`id_country` = 6) LIMIT 1 |
0.402 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 111 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM och438feature_product pf LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1) LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1) LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1) INNER JOIN och438feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 2208 ORDER BY f.position ASC |
0.402 ms | 1 | Yes | /classes/Product.php:6024 | |
| 123 | SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `och438currency` c LEFT JOIN och438currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1) WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1 |
0.394 ms | 1 | /classes/Currency.php:1134 | ||
| 113 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `och438image` i INNER JOIN och438image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1) WHERE i.`id_product` = 2208 ORDER BY `position` |
0.390 ms | 4 | Yes | /classes/Product.php:3539 | |
| 103 | SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.386 ms | 1 | Yes | /classes/tax/TaxRulesTaxManager.php:100 | |
| 62 | SELECT SQL_NO_CACHE * FROM `och438category` a0 LEFT JOIN `och438category_lang` `a1` ON (a0.`id_category` = a1.`id_category`) WHERE (a0.`nleft` < 7) AND (a0.`nright` > 40) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1) ORDER BY a0.`nleft` asc |
0.384 ms | 4 | /classes/PrestaShopCollection.php:383 | ||
| 117 | SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c WHERE c.id_category = 22 LIMIT 1 |
0.381 ms | 1 | /modules/iqitelementor/src/IqitElementorCategory.php:87 | ||
| 120 | SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.364 ms | 13 | /classes/CartRule.php:357 | ||
| 53 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 275) AND (b.`id_shop` = 1) LIMIT 1 |
0.360 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 35 | SELECT SQL_NO_CACHE `id_category` FROM `och438category_shop` WHERE `id_category` = 22 AND `id_shop` = 1 LIMIT 1 |
0.354 ms | 1 | /classes/Category.php:2446 | ||
| 108 | SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.350 ms | 0 | /classes/tax/TaxRulesTaxManager.php:100 | ||
| 93 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `och438image` i INNER JOIN och438image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 2208 AND image_shop.`cover` = 1 LIMIT 1 |
0.349 ms | 4 | /classes/Product.php:3570 | ||
| 32 | SELECT SQL_NO_CACHE * FROM `och438group` a LEFT JOIN `och438group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1 WHERE (a.`id_group` = 1) LIMIT 1 |
0.346 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 56 | SELECT SQL_NO_CACHE * FROM `och438image_type` WHERE 1 AND `products` = 1 ORDER BY `width` DESC, `height` DESC, `name`ASC |
0.346 ms | 8 | Yes | /classes/ImageType.php:109 | |
| 134 | SELECT SQL_NO_CACHE SUM(`quantity`) FROM `och438cart_product` WHERE `id_cart` = 0 LIMIT 1 |
0.345 ms | 1 | /classes/Cart.php:1300 | ||
| 99 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `och438product` p INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 2208) |
0.345 ms | 1 | /classes/Product.php:3860 | ||
| 143 | SELECT SQL_NO_CACHE `id_category` FROM `och438category_product` WHERE `id_product` = 2208 |
0.338 ms | 4 | /classes/Product.php:3420 | ||
| 31 | SELECT SQL_NO_CACHE id_shop FROM `och438currency_shop` WHERE `id_currency` = 1 AND id_shop = 1 LIMIT 1 |
0.335 ms | 1 | /classes/ObjectModel.php:1727 | ||
| 115 | SELECT SQL_NO_CACHE state FROM och438feature_flag WHERE name = 'multiple_image_format' LIMIT 1 |
0.332 ms | 1 | /classes/FeatureFlag.php:105 | ||
| 43 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 42) AND (b.`id_shop` = 1) LIMIT 1 |
0.331 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 97 | SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 0 LIMIT 1 |
0.329 ms | 1 | /classes/SpecificPrice.php:426 | ||
| 72 | SELECT SQL_NO_CACHE data FROM och438layered_filter_block WHERE hash="ba08a8244b89a2a1773701496f99615f" LIMIT 1 |
0.325 ms | 1 | /modules/ps_facetedsearch/src/Filters/Block.php:186 | ||
| 109 | SELECT SQL_NO_CACHE SUM(quantity) FROM `och438stock_available` WHERE (id_product = 2208) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.323 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 116 | SELECT SQL_NO_CACHE * FROM `och438image_type` |
0.323 ms | 8 | /classes/ImageType.php:161 | ||
| 100 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `och438product_shop` WHERE `id_product` = 2208 AND id_shop=1 LIMIT 1 |
0.321 ms | 1 | /classes/Product.php:6884 | ||
| 45 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1 |
0.320 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 38 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 26) AND (b.`id_shop` = 1) LIMIT 1 |
0.319 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 44 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 43) AND (b.`id_shop` = 1) LIMIT 1 |
0.317 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 98 | SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2208 LIMIT 1 |
0.311 ms | 1 | /classes/SpecificPrice.php:435 | ||
| 125 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1 |
0.311 ms | 1 | /classes/module/Module.php:2137 | ||
| 39 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 29) AND (b.`id_shop` = 1) LIMIT 1 |
0.309 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 124 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_languageselector" LIMIT 1 |
0.309 ms | 1 | /classes/module/Module.php:2664 | ||
| 139 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitproductsnav" LIMIT 1 |
0.309 ms | 1 | /classes/module/Module.php:2664 | ||
| 34 | SELECT SQL_NO_CACHE id_shop FROM `och438group_shop` WHERE `id_group` = 1 AND id_shop = 1 LIMIT 1 |
0.308 ms | 1 | /classes/ObjectModel.php:1727 | ||
| 121 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitlinksmanager" LIMIT 1 |
0.306 ms | 1 | /classes/module/Module.php:2664 | ||
| 132 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsearch" LIMIT 1 |
0.306 ms | 1 | /classes/module/Module.php:2664 | ||
| 60 | SELECT SQL_NO_CACHE * FROM `och438country_lang` WHERE `id_country` = 6 |
0.298 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 33 | SELECT SQL_NO_CACHE * FROM `och438group_lang` WHERE `id_group` = 1 |
0.296 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 61 | SELECT SQL_NO_CACHE id_required_field, object_name, field_name FROM och438required_field |
0.295 ms | 1 | /classes/ObjectModel.php:1592 | ||
| 106 | SELECT SQL_NO_CACHE `reduction` FROM `och438product_group_reduction_cache` WHERE `id_product` = 2208 AND `id_group` = 1 LIMIT 1 |
0.295 ms | 0 | /classes/GroupReduction.php:153 | ||
| 135 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_shoppingcart" LIMIT 1 |
0.295 ms | 1 | /classes/module/Module.php:2664 | ||
| 141 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_facetedsearch" LIMIT 1 |
0.295 ms | 1 | /classes/module/Module.php:2664 | ||
| 41 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1 |
0.294 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 47 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 94) AND (b.`id_shop` = 1) LIMIT 1 |
0.294 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 128 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitwishlist" LIMIT 1 |
0.293 ms | 1 | /classes/module/Module.php:2664 | ||
| 46 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 45) AND (b.`id_shop` = 1) LIMIT 1 |
0.292 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 94 | SELECT SQL_NO_CACHE cl.`link_rewrite` FROM `och438category_lang` cl WHERE `id_lang` = 1 AND cl.id_shop = 1 AND cl.`id_category` = 22 LIMIT 1 |
0.290 ms | 1 | /classes/Category.php:1373 | ||
| 114 | SELECT SQL_NO_CACHE `id_product_attribute` FROM `och438product_attribute` WHERE `id_product` = 2208 |
0.289 ms | 1 | /classes/Product.php:2899 | ||
| 50 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 138) AND (b.`id_shop` = 1) LIMIT 1 |
0.288 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 57 | SELECT SQL_NO_CACHE format FROM `och438address_format` WHERE `id_country` = 6 LIMIT 1 |
0.288 ms | 1 | /classes/AddressFormat.php:653 | ||
| 65 | SELECT SQL_NO_CACHE `id_category` FROM `och438category_shop` WHERE `id_category` = 22 AND `id_shop` = 1 LIMIT 1 |
0.288 ms | 1 | /classes/Category.php:2446 | ||
| 52 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 274) AND (b.`id_shop` = 1) LIMIT 1 |
0.287 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 48 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1 |
0.286 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 137 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitmegamenu" LIMIT 1 |
0.286 ms | 1 | /classes/module/Module.php:2664 | ||
| 107 | SELECT SQL_NO_CACHE `reduction` FROM `och438group` WHERE `id_group` = 1 LIMIT 1 |
0.280 ms | 1 | /classes/Group.php:151 | ||
| 126 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_currencyselector" LIMIT 1 |
0.279 ms | 1 | /classes/module/Module.php:2664 | ||
| 49 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1 |
0.277 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 42 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 41) AND (b.`id_shop` = 1) LIMIT 1 |
0.276 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 122 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1 |
0.276 ms | 1 | /classes/module/Module.php:2137 | ||
| 55 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.276 ms | 0 | /classes/module/Module.php:2137 | ||
| 40 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1 |
0.274 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 133 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1 |
0.274 ms | 1 | /classes/module/Module.php:2137 | ||
| 51 | SELECT SQL_NO_CACHE * FROM `och438category` a LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 272) AND (b.`id_shop` = 1) LIMIT 1 |
0.272 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 104 | SELECT SQL_NO_CACHE * FROM `och438tax` a WHERE (a.`id_tax` = 31) LIMIT 1 |
0.271 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 105 | SELECT SQL_NO_CACHE * FROM `och438tax_lang` WHERE `id_tax` = 31 |
0.271 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 130 | SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcompare" LIMIT 1 |
0.270 ms | 1 | /classes/module/Module.php:2664 | ||
| 129 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1 |
0.270 ms | 1 | /classes/module/Module.php:2137 | ||
| 95 | SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1 |
0.269 ms | 1 | /classes/Product.php:5670 | ||
| 36 | SELECT SQL_NO_CACHE ctg.`id_group` FROM och438category_group ctg WHERE ctg.`id_category` = 22 AND ctg.`id_group` = 1 LIMIT 1 |
0.263 ms | 1 | /classes/Category.php:1751 | ||
| 138 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1 |
0.260 ms | 1 | /classes/module/Module.php:2137 | ||
| 96 | SELECT SQL_NO_CACHE `name` FROM `och438manufacturer` WHERE `id_manufacturer` = 94 AND `active` = 1 LIMIT 1 |
0.258 ms | 1 | /classes/Manufacturer.php:312 | ||
| 136 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 32 AND `id_shop` = 1 LIMIT 1 |
0.258 ms | 1 | /classes/module/Module.php:2137 | ||
| 127 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1 |
0.257 ms | 1 | /classes/module/Module.php:2137 | ||
| 131 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 69 AND `id_shop` = 1 LIMIT 1 |
0.257 ms | 1 | /classes/module/Module.php:2137 | ||
| 142 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 64 AND `id_shop` = 1 LIMIT 1 |
0.255 ms | 1 | /classes/module/Module.php:2137 | ||
| 58 | SELECT SQL_NO_CACHE `need_identification_number` FROM `och438country` WHERE `id_country` = 6 LIMIT 1 |
0.251 ms | 1 | /classes/Country.php:402 | ||
| 140 | SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1 |
0.251 ms | 1 | /classes/module/Module.php:2137 |
| 18 queries |
SELECT * FROM `ochXXcategory` a LEFT JOIN `ochXXcategory_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX LEFT JOIN `ochXXcategory_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX |
| 18 queries |
SELECT `id_module` FROM `ochXXmodule_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX |
| 4 queries |
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `ochXXattribute_group` ag INNER JOIN `ochXXattribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `ochXXattribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN ochXXattribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX) INNER JOIN ochXXattribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `ochXXlayered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
|
| 4 queries |
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND cp.id_category='XX' AND p.id_manufacturer IN (XX, XX, XX, XX, XX, XX) GROUP BY p.id_product) p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN ochXXattribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
|
| 2 queries |
SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ochXXmodule` m
LEFT JOIN `ochXXmodule_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = XX
|
| 2 queries |
SELECT `id_lang` FROM `ochXXlang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT XX
|
| 2 queries |
SELECT `id_category` FROM `ochXXcategory_shop` WHERE `id_category` = XX AND `id_shop` = XX LIMIT XX |
| 2 queries |
SELECT m.*, ml.`description`, ml.`short_description`
FROM `ochXXmanufacturer` m INNER JOIN ochXXmanufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `ochXXmanufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
|
| 2 queries |
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND cp.id_category='XX' AND p.id_manufacturer IN (XX, XX, XX, XX, XX, XX) GROUP BY p.id_product) p INNER JOIN ochXXfeature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
|
| 2 queries |
SELECT XX FROM `ochXXspecific_price` WHERE id_product = XX LIMIT XX |
| 2 queries |
SELECT tr.*
FROM `ochXXtax_rule` tr
JOIN `ochXXtax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = XX
AND tr.`id_country` = XX
AND tr.`id_tax_rules_group` = XX
AND tr.`id_state` IN (XX, XX)
AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
|
| 2 queries |
SELECT XX FROM `ochXXcart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX |
| 43 category |
| 29 category_lang |
| 24 category_shop |
| 22 module |
| 21 module_shop |
| 18 product |
| 18 product_attribute |
| 18 product_shop |
| 17 category_group |
| 17 product_attribute_combination |
| 17 category_product |
| 14 stock_available |
| 12 product_sale |
| 9 attribute |
| 7 hook |
| 6 attribute_group |
| 5 lang |
| 5 currency |
| 5 attribute_group_shop |
| 5 attribute_group_lang |
| 5 attribute_lang |
| 4 shop_url |
| 4 shop |
| 4 lang_shop |
| 4 currency_shop |
| 4 attribute_shop |
| 4 layered_indexable_attribute_lang_value |
| 4 cart_product |
| 3 country |
| 3 hook_alias |
| 3 manufacturer |
| 3 feature_product |
| 3 specific_price |
| 2 shop_group |
| 2 configuration |
| 2 country_lang |
| 2 country_shop |
| 2 hook_module |
| 2 currency_lang |
| 2 group |
| 2 group_shop |
| 2 image_type |
| 2 feature |
| 2 feature_shop |
| 2 feature_lang |
| 2 manufacturer_shop |
| 2 manufacturer_lang |
| 2 product_lang |
| 2 image |
| 2 image_shop |
| 2 product_attribute_shop |
| 2 tax_rule |
| 2 tax_rules_group |
| 2 iqit_elementor_category |
| 2 cart_rule |
| 1 memcached_servers |
| 1 configuration_lang |
| 1 module_group |
| 1 meta |
| 1 meta_lang |
| 1 hook_module_exceptions |
| 1 group_lang |
| 1 address_format |
| 1 required_field |
| 1 revslider_sliders |
| 1 layered_category |
| 1 layered_indexable_attribute_group |
| 1 layered_indexable_attribute_group_lang_value |
| 1 layered_indexable_feature |
| 1 layered_indexable_feature_lang_value |
| 1 layered_filter_block |
| 1 layered_price_index |
| 1 tax |
| 1 tax_lang |
| 1 product_group_reduction_cache |
| 1 pack |
| 1 feature_value_lang |
| 1 image_lang |
| 1 feature_flag |
| 1 iqitreviews_products |
| 1 iqit_elementor_category_shop |
| 1 connections |
| 1 ganalytics_data |
| Name | Instances | Source |
|---|---|---|
| Category | 22 |
/controllers/front/listing/CategoryController.php:76 (__construct) [id: 22]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 26] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 29] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 33] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 40] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 41] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 42] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 43] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 44] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 45] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 94] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 130] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 131] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 138] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 272] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 274] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 275] /classes/Meta.php:379 (__construct) [id: 22] /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ] /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ] /modules/ps_facetedsearch/src/Filters/Block.php:158 (__construct) [id: 22] /modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2] |
| Address | 4 |
/classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ] /classes/Product.php:3804 (__construct) [id: ] /classes/Product.php:5975 (__construct) [id: ] |
| Country | 3 |
/config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6] /classes/controller/FrontController.php:1769 (__construct) [id: 6] |
| Language | 2 |
/config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1] |
| Currency | 2 |
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1] |
| Cart | 2 |
/classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ] |
| State | 2 |
/classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1768 (__construct) [id: 0] |
| Shop | 1 |
/config/config.inc.php:117 (initialize) [id: 1]
|
| IqitElementorCategory | 1 |
/modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
|
| Product | 1 |
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2208]
|
| Tax | 1 |
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 31]
|
| Gender | 1 |
/classes/controller/FrontController.php:1692 (__construct) [id: 0]
|
| AddressFormat | 1 |
/classes/controller/FrontController.php:1763 (generateAddress) [id: ]
|
| Risk | 1 |
/classes/controller/FrontController.php:1695 (__construct) [id: ]
|
| Group | 1 |
/classes/Cart.php:249 (getCurrent) [id: 1]
|
| Customer | 1 |
/config/config.inc.php:264 (__construct) [id: ]
|
| ShopGroup | 1 |
/classes/shop/Shop.php:561 (__construct) [id: 1]
|
| ConnectionsSource | 1 |
/modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]
|
| # | Filename |
|---|---|
| 0 | /index.php |
| 1 | /config/config.inc.php |
| 2 | /config/defines.inc.php |
| 3 | /config/autoload.php |
| 4 | /vendor/autoload.php |
| 5 | /vendor/composer/autoload_real.php |
| 6 | /vendor/composer/platform_check.php |
| 7 | /vendor/composer/ClassLoader.php |
| 8 | /vendor/composer/include_paths.php |
| 9 | /vendor/composer/autoload_static.php |
| 10 | /vendor/symfony/polyfill-php72/bootstrap.php |
| 11 | /vendor/symfony/polyfill-mbstring/bootstrap.php |
| 12 | /vendor/symfony/polyfill-mbstring/bootstrap80.php |
| 13 | /vendor/symfony/polyfill-intl-normalizer/bootstrap.php |
| 14 | /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php |
| 15 | /vendor/symfony/polyfill-intl-idn/bootstrap.php |
| 16 | /vendor/symfony/deprecation-contracts/function.php |
| 17 | /vendor/ralouphie/getallheaders/src/getallheaders.php |
| 18 | /vendor/symfony/polyfill-ctype/bootstrap.php |
| 19 | /vendor/symfony/polyfill-ctype/bootstrap80.php |
| 20 | /vendor/symfony/polyfill-php80/bootstrap.php |
| 21 | /vendor/guzzlehttp/promises/src/functions_include.php |
| 22 | /vendor/guzzlehttp/promises/src/functions.php |
| 23 | /vendor/guzzlehttp/guzzle/src/functions_include.php |
| 24 | /vendor/guzzlehttp/guzzle/src/functions.php |
| 25 | /vendor/symfony/polyfill-iconv/bootstrap.php |
| 26 | /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php |
| 27 | /vendor/jakeasmith/http_build_url/src/http_build_url.php |
| 28 | /vendor/lcobucci/jwt/compat/class-aliases.php |
| 29 | /vendor/lcobucci/jwt/src/Token.php |
| 30 | /vendor/lcobucci/jwt/src/Signature.php |
| 31 | /vendor/lcobucci/jwt/compat/json-exception-polyfill.php |
| 32 | /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php |
| 33 | /vendor/swiftmailer/swiftmailer/lib/swift_required.php |
| 34 | /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php |
| 35 | /vendor/symfony/polyfill-intl-icu/bootstrap.php |
| 36 | /vendor/symfony/polyfill-php73/bootstrap.php |
| 37 | /vendor/symfony/polyfill-php81/bootstrap.php |
| 38 | /vendor/api-platform/core/src/deprecation.php |
| 39 | /vendor/api-platform/core/src/Api/FilterInterface.php |
| 40 | /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php |
| 41 | /vendor/api-platform/core/src/deprecated_interfaces.php |
| 42 | /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php |
| 43 | /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php |
| 44 | /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php |
| 45 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php |
| 46 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php |
| 47 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php |
| 48 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php |
| 49 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php |
| 50 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php |
| 51 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php |
| 52 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php |
| 53 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php |
| 54 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php |
| 55 | /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php |
| 56 | /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php |
| 57 | /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php |
| 58 | /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php |
| 59 | /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php |
| 60 | /vendor/api-platform/core/src/Exception/ExceptionInterface.php |
| 61 | /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php |
| 62 | /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php |
| 63 | /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php |
| 64 | /vendor/api-platform/core/src/Documentation/DocumentationInterface.php |
| 65 | /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php |
| 66 | /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php |
| 67 | /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php |
| 68 | /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php |
| 69 | /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php |
| 70 | /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php |
| 71 | /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php |
| 72 | /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php |
| 73 | /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php |
| 74 | /vendor/api-platform/core/src/Validator/ValidatorInterface.php |
| 75 | /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php |
| 76 | /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php |
| 77 | /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php |
| 78 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php |
| 79 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php |
| 80 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php |
| 81 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php |
| 82 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php |
| 83 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php |
| 84 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php |
| 85 | /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php |
| 86 | /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php |
| 87 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php |
| 88 | /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php |
| 89 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php |
| 90 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php |
| 91 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php |
| 92 | /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php |
| 93 | /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php |
| 94 | /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php |
| 95 | /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php |
| 96 | /vendor/psr/container/src/ContainerInterface.php |
| 97 | /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php |
| 98 | /vendor/ircmaxell/password-compat/lib/password.php |
| 99 | /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php |
| 100 | /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php |
| 101 | /src/Core/Version.php |
| 102 | /config/alias.php |
| 103 | /vendor/prestashop/autoload/src/PrestashopAutoload.php |
| 104 | /vendor/prestashop/autoload/src/LegacyClassLoader.php |
| 105 | /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php |
| 106 | /vendor/prestashop/autoload/src/Autoloader.php |
| 107 | /config/bootstrap.php |
| 108 | /src/Core/ContainerBuilder.php |
| 109 | /src/Core/Foundation/IoC/Container.php |
| 110 | /src/Adapter/ServiceLocator.php |
| 111 | /var/cache/dev/appParameters.php |
| 114 | /var/cache/dev/class_index.php |
| 115 | /classes/controller/Controller.php |
| 117 | /classes/ObjectModel.php |
| 118 | /src/Core/Foundation/Database/EntityInterface.php |
| 120 | /classes/db/Db.php |
| 122 | /classes/Hook.php |
| 124 | /classes/module/Module.php |
| 125 | /src/Core/Module/Legacy/ModuleInterface.php |
| 127 | /classes/Tools.php |
| 128 | /classes/Context.php |
| 129 | /classes/shop/Shop.php |
| 130 | /src/Core/Security/PasswordGenerator.php |
| 131 | /classes/db/DbPDO.php |
| 132 | /classes/AddressFormat.php |
| 133 | /classes/cache/Cache.php |
| 134 | /classes/cache/CacheMemcached.php |
| 135 | /config/db_slave_server.inc.php |
| 136 | /src/Core/Security/Hashing.php |
| 137 | /classes/Configuration.php |
| 138 | /classes/Validate.php |
| 139 | /src/Adapter/EntityMapper.php |
| 140 | /classes/db/DbQuery.php |
| 141 | /src/Core/Addon/Theme/ThemeManagerBuilder.php |
| 142 | /vendor/psr/log/Psr/Log/NullLogger.php |
| 143 | /vendor/psr/log/Psr/Log/AbstractLogger.php |
| 144 | /vendor/psr/log/Psr/Log/LoggerInterface.php |
| 145 | /src/Adapter/Configuration.php |
| 146 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php |
| 147 | /src/Core/Domain/Configuration/ShopConfigurationInterface.php |
| 148 | /src/Core/ConfigurationInterface.php |
| 149 | /src/Core/Addon/Theme/ThemeRepository.php |
| 150 | /src/Core/Addon/AddonRepositoryInterface.php |
| 151 | /src/Core/Domain/Shop/ValueObject/ShopConstraint.php |
| 152 | /src/Core/Addon/Theme/Theme.php |
| 153 | /src/Core/Addon/AddonInterface.php |
| 154 | /src/Core/Util/ArrayFinder.php |
| 155 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php |
| 156 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php |
| 157 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php |
| 158 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php |
| 159 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php |
| 160 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php |
| 161 | /config/defines_uri.inc.php |
| 162 | /classes/Language.php |
| 163 | /src/Core/Language/LanguageInterface.php |
| 164 | /classes/Country.php |
| 165 | /classes/PrestaShopCollection.php |
| 166 | /classes/shop/ShopGroup.php |
| 167 | /classes/Cookie.php |
| 168 | /classes/PhpEncryption.php |
| 169 | /classes/PhpEncryptionEngine.php |
| 170 | /vendor/defuse/php-encryption/src/Key.php |
| 171 | /vendor/defuse/php-encryption/src/Encoding.php |
| 172 | /vendor/defuse/php-encryption/src/Core.php |
| 173 | /vendor/defuse/php-encryption/src/Crypto.php |
| 174 | /vendor/defuse/php-encryption/src/KeyOrPassword.php |
| 175 | /vendor/defuse/php-encryption/src/RuntimeTests.php |
| 176 | /vendor/defuse/php-encryption/src/DerivedKeys.php |
| 177 | /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php |
| 178 | /vendor/defuse/php-encryption/src/Exception/CryptoException.php |
| 179 | /src/Core/Session/SessionHandler.php |
| 180 | /src/Core/Session/SessionHandlerInterface.php |
| 181 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php |
| 182 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php |
| 183 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php |
| 184 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php |
| 185 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php |
| 186 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php |
| 187 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php |
| 188 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php |
| 189 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php |
| 190 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php |
| 191 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php |
| 192 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php |
| 193 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php |
| 194 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php |
| 195 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php |
| 196 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php |
| 197 | /config/smarty.config.inc.php |
| 198 | /classes/Smarty/SmartyDev.php |
| 199 | /vendor/smarty/smarty/libs/Smarty.class.php |
| 200 | /vendor/smarty/smarty/libs/functions.php |
| 201 | /vendor/smarty/smarty/libs/Autoloader.php |
| 202 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php |
| 203 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php |
| 204 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php |
| 205 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php |
| 206 | /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php |
| 207 | /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php |
| 208 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php |
| 209 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php |
| 210 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php |
| 211 | /config/smartyfront.config.inc.php |
| 212 | /classes/Smarty/SmartyResourceModule.php |
| 213 | /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php |
| 214 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php |
| 215 | /classes/Smarty/SmartyResourceParent.php |
| 216 | /classes/Smarty/SmartyLazyRegister.php |
| 217 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php |
| 218 | /vendor/smarty/smarty/libs/plugins/modifier.truncate.php |
| 219 | /classes/Customer.php |
| 220 | /classes/Group.php |
| 221 | /classes/Link.php |
| 222 | /classes/shop/ShopUrl.php |
| 223 | /classes/Dispatcher.php |
| 224 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php |
| 225 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php |
| 226 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php |
| 227 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php |
| 228 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php |
| 229 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php |
| 230 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php |
| 231 | /src/Adapter/SymfonyContainer.php |
| 232 | /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php |
| 233 | /src/Adapter/ContainerBuilder.php |
| 234 | /src/Adapter/Environment.php |
| 235 | /src/Core/EnvironmentInterface.php |
| 236 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php |
| 237 | /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php |
| 238 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php |
| 239 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php |
| 240 | /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php |
| 241 | /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php |
| 242 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php |
| 243 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php |
| 244 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php |
| 245 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php |
| 246 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php |
| 247 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php |
| 248 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php |
| 249 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php |
| 250 | /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php |
| 251 | /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php |
| 252 | /vendor/symfony/contracts/Service/ResetInterface.php |
| 253 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php |
| 254 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php |
| 255 | /vendor/psr/log/Psr/Log/LoggerAwareTrait.php |
| 256 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php |
| 257 | /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php |
| 258 | /vendor/symfony/contracts/Cache/ItemInterface.php |
| 259 | /vendor/psr/cache/src/CacheItemInterface.php |
| 260 | /vendor/psr/cache/src/CacheItemPoolInterface.php |
| 261 | /vendor/symfony/contracts/Cache/CacheInterface.php |
| 262 | /vendor/psr/log/Psr/Log/LoggerAwareInterface.php |
| 263 | /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php |
| 264 | /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php |
| 265 | /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php |
| 266 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php |
| 267 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php |
| 268 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php |
| 269 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php |
| 270 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php |
| 271 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php |
| 272 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php |
| 273 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php |
| 274 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php |
| 275 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php |
| 276 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php |
| 277 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php |
| 278 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php |
| 279 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php |
| 280 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php |
| 281 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php |
| 282 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php |
| 283 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php |
| 284 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php |
| 285 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php |
| 286 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php |
| 287 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php |
| 288 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php |
| 289 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php |
| 290 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php |
| 291 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php |
| 292 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php |
| 293 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php |
| 294 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php |
| 295 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php |
| 296 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php |
| 297 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php |
| 298 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php |
| 299 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php |
| 300 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php |
| 301 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php |
| 302 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php |
| 303 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php |
| 304 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php |
| 305 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php |
| 306 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php |
| 307 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php |
| 308 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php |
| 309 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php |
| 310 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php |
| 311 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php |
| 312 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php |
| 313 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php |
| 314 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php |
| 315 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php |
| 316 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php |
| 317 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php |
| 318 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php |
| 319 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php |
| 320 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php |
| 321 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php |
| 322 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php |
| 323 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php |
| 324 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php |
| 325 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php |
| 326 | /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php |
| 327 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php |
| 328 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php |
| 329 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php |
| 330 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php |
| 331 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php |
| 332 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php |
| 333 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php |
| 334 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php |
| 335 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php |
| 336 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php |
| 337 | /var/cache/dev/FrontContainer.php |
| 338 | /src/Adapter/Container/LegacyContainer.php |
| 339 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php |
| 340 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php |
| 341 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php |
| 342 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php |
| 343 | /vendor/symfony/contracts/Service/ServiceLocatorTrait.php |
| 344 | /vendor/psr/container/src/ContainerExceptionInterface.php |
| 345 | /vendor/psr/container/src/NotFoundExceptionInterface.php |
| 346 | /vendor/symfony/contracts/Service/ServiceProviderInterface.php |
| 347 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php |
| 348 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php |
| 349 | /src/Adapter/Container/LegacyContainerInterface.php |
| 350 | /modules/blockwishlist/vendor/autoload.php |
| 351 | /modules/blockwishlist/vendor/composer/autoload_real.php |
| 352 | /modules/blockwishlist/vendor/composer/autoload_static.php |
| 353 | /modules/contactform/vendor/autoload.php |
| 354 | /modules/contactform/vendor/composer/autoload_real.php |
| 355 | /modules/contactform/vendor/composer/autoload_static.php |
| 356 | /modules/dashactivity/vendor/autoload.php |
| 357 | /modules/dashactivity/vendor/composer/autoload_real.php |
| 358 | /modules/dashactivity/vendor/composer/platform_check.php |
| 359 | /modules/dashactivity/vendor/composer/autoload_static.php |
| 360 | /modules/dashtrends/vendor/autoload.php |
| 361 | /modules/dashtrends/vendor/composer/autoload_real.php |
| 362 | /modules/dashtrends/vendor/composer/autoload_static.php |
| 363 | /modules/dashgoals/vendor/autoload.php |
| 364 | /modules/dashgoals/vendor/composer/autoload_real.php |
| 365 | /modules/dashgoals/vendor/composer/platform_check.php |
| 366 | /modules/dashgoals/vendor/composer/autoload_static.php |
| 367 | /modules/dashproducts/vendor/autoload.php |
| 368 | /modules/dashproducts/vendor/composer/autoload_real.php |
| 369 | /modules/dashproducts/vendor/composer/platform_check.php |
| 370 | /modules/dashproducts/vendor/composer/autoload_static.php |
| 371 | /modules/graphnvd3/vendor/autoload.php |
| 372 | /modules/graphnvd3/vendor/composer/autoload_real.php |
| 373 | /modules/graphnvd3/vendor/composer/autoload_static.php |
| 374 | /modules/gridhtml/vendor/autoload.php |
| 375 | /modules/gridhtml/vendor/composer/autoload_real.php |
| 376 | /modules/gridhtml/vendor/composer/autoload_static.php |
| 377 | /modules/gsitemap/vendor/autoload.php |
| 378 | /modules/gsitemap/vendor/composer/autoload_real.php |
| 379 | /modules/gsitemap/vendor/composer/platform_check.php |
| 380 | /modules/gsitemap/vendor/composer/autoload_static.php |
| 381 | /modules/pagesnotfound/vendor/autoload.php |
| 382 | /modules/pagesnotfound/vendor/composer/autoload_real.php |
| 383 | /modules/pagesnotfound/vendor/composer/platform_check.php |
| 384 | /modules/pagesnotfound/vendor/composer/autoload_static.php |
| 385 | /modules/productcomments/vendor/autoload.php |
| 386 | /modules/productcomments/vendor/composer/autoload_real.php |
| 387 | /modules/productcomments/vendor/composer/platform_check.php |
| 388 | /modules/productcomments/vendor/composer/autoload_static.php |
| 389 | /modules/ps_categorytree/vendor/autoload.php |
| 390 | /modules/ps_categorytree/vendor/composer/autoload_real.php |
| 391 | /modules/ps_categorytree/vendor/composer/platform_check.php |
| 392 | /modules/ps_categorytree/vendor/composer/autoload_static.php |
| 393 | /modules/ps_checkpayment/vendor/autoload.php |
| 394 | /modules/ps_checkpayment/vendor/composer/autoload_real.php |
| 395 | /modules/ps_checkpayment/vendor/composer/autoload_static.php |
| 396 | /modules/ps_crossselling/vendor/autoload.php |
| 397 | /modules/ps_crossselling/vendor/composer/autoload_real.php |
| 398 | /modules/ps_crossselling/vendor/composer/platform_check.php |
| 399 | /modules/ps_crossselling/vendor/composer/autoload_static.php |
| 400 | /modules/ps_currencyselector/vendor/autoload.php |
| 401 | /modules/ps_currencyselector/vendor/composer/autoload_real.php |
| 402 | /modules/ps_currencyselector/vendor/composer/autoload_static.php |
| 403 | /modules/ps_customeraccountlinks/vendor/autoload.php |
| 404 | /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php |
| 405 | /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php |
| 406 | /modules/ps_customersignin/vendor/autoload.php |
| 407 | /modules/ps_customersignin/vendor/composer/autoload_real.php |
| 408 | /modules/ps_customersignin/vendor/composer/autoload_static.php |
| 409 | /modules/ps_dataprivacy/vendor/autoload.php |
| 410 | /modules/ps_dataprivacy/vendor/composer/autoload_real.php |
| 411 | /modules/ps_dataprivacy/vendor/composer/autoload_static.php |
| 412 | /modules/ps_emailsubscription/vendor/autoload.php |
| 413 | /modules/ps_emailsubscription/vendor/composer/autoload_real.php |
| 414 | /modules/ps_emailsubscription/vendor/composer/platform_check.php |
| 415 | /modules/ps_emailsubscription/vendor/composer/autoload_static.php |
| 416 | /modules/ps_faviconnotificationbo/vendor/autoload.php |
| 417 | /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php |
| 418 | /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php |
| 419 | /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php |
| 420 | /modules/ps_languageselector/vendor/autoload.php |
| 421 | /modules/ps_languageselector/vendor/composer/autoload_real.php |
| 422 | /modules/ps_languageselector/vendor/composer/autoload_static.php |
| 423 | /modules/ps_sharebuttons/vendor/autoload.php |
| 424 | /modules/ps_sharebuttons/vendor/composer/autoload_real.php |
| 425 | /modules/ps_sharebuttons/vendor/composer/autoload_static.php |
| 426 | /modules/ps_shoppingcart/vendor/autoload.php |
| 427 | /modules/ps_shoppingcart/vendor/composer/autoload_real.php |
| 428 | /modules/ps_shoppingcart/vendor/composer/autoload_static.php |
| 429 | /modules/ps_wirepayment/vendor/autoload.php |
| 430 | /modules/ps_wirepayment/vendor/composer/autoload_real.php |
| 431 | /modules/ps_wirepayment/vendor/composer/platform_check.php |
| 432 | /modules/ps_wirepayment/vendor/composer/autoload_static.php |
| 433 | /modules/statsbestcategories/vendor/autoload.php |
| 434 | /modules/statsbestcategories/vendor/composer/autoload_real.php |
| 435 | /modules/statsbestcategories/vendor/composer/platform_check.php |
| 436 | /modules/statsbestcategories/vendor/composer/autoload_static.php |
| 437 | /modules/statsbestcustomers/vendor/autoload.php |
| 438 | /modules/statsbestcustomers/vendor/composer/autoload_real.php |
| 439 | /modules/statsbestcustomers/vendor/composer/platform_check.php |
| 440 | /modules/statsbestcustomers/vendor/composer/autoload_static.php |
| 441 | /modules/statsbestproducts/vendor/autoload.php |
| 442 | /modules/statsbestproducts/vendor/composer/autoload_real.php |
| 443 | /modules/statsbestproducts/vendor/composer/platform_check.php |
| 444 | /modules/statsbestproducts/vendor/composer/autoload_static.php |
| 445 | /modules/statsbestsuppliers/vendor/autoload.php |
| 446 | /modules/statsbestsuppliers/vendor/composer/autoload_real.php |
| 447 | /modules/statsbestsuppliers/vendor/composer/platform_check.php |
| 448 | /modules/statsbestsuppliers/vendor/composer/autoload_static.php |
| 449 | /modules/statsbestvouchers/vendor/autoload.php |
| 450 | /modules/statsbestvouchers/vendor/composer/autoload_real.php |
| 451 | /modules/statsbestvouchers/vendor/composer/platform_check.php |
| 452 | /modules/statsbestvouchers/vendor/composer/autoload_static.php |
| 453 | /modules/statscarrier/vendor/autoload.php |
| 454 | /modules/statscarrier/vendor/composer/autoload_real.php |
| 455 | /modules/statscarrier/vendor/composer/platform_check.php |
| 456 | /modules/statscarrier/vendor/composer/autoload_static.php |
| 457 | /modules/statscatalog/vendor/autoload.php |
| 458 | /modules/statscatalog/vendor/composer/autoload_real.php |
| 459 | /modules/statscatalog/vendor/composer/platform_check.php |
| 460 | /modules/statscatalog/vendor/composer/autoload_static.php |
| 461 | /modules/statscheckup/vendor/autoload.php |
| 462 | /modules/statscheckup/vendor/composer/autoload_real.php |
| 463 | /modules/statscheckup/vendor/composer/platform_check.php |
| 464 | /modules/statscheckup/vendor/composer/autoload_static.php |
| 465 | /modules/statsdata/vendor/autoload.php |
| 466 | /modules/statsdata/vendor/composer/autoload_real.php |
| 467 | /modules/statsdata/vendor/composer/autoload_static.php |
| 468 | /modules/statsforecast/vendor/autoload.php |
| 469 | /modules/statsforecast/vendor/composer/autoload_real.php |
| 470 | /modules/statsforecast/vendor/composer/platform_check.php |
| 471 | /modules/statsforecast/vendor/composer/autoload_static.php |
| 472 | /modules/statsnewsletter/vendor/autoload.php |
| 473 | /modules/statsnewsletter/vendor/composer/autoload_real.php |
| 474 | /modules/statsnewsletter/vendor/composer/platform_check.php |
| 475 | /modules/statsnewsletter/vendor/composer/autoload_static.php |
| 476 | /modules/statspersonalinfos/vendor/autoload.php |
| 477 | /modules/statspersonalinfos/vendor/composer/autoload_real.php |
| 478 | /modules/statspersonalinfos/vendor/composer/platform_check.php |
| 479 | /modules/statspersonalinfos/vendor/composer/autoload_static.php |
| 480 | /modules/statsproduct/vendor/autoload.php |
| 481 | /modules/statsproduct/vendor/composer/autoload_real.php |
| 482 | /modules/statsproduct/vendor/composer/platform_check.php |
| 483 | /modules/statsproduct/vendor/composer/autoload_static.php |
| 484 | /modules/statsregistrations/vendor/autoload.php |
| 485 | /modules/statsregistrations/vendor/composer/autoload_real.php |
| 486 | /modules/statsregistrations/vendor/composer/platform_check.php |
| 487 | /modules/statsregistrations/vendor/composer/autoload_static.php |
| 488 | /modules/statssales/vendor/autoload.php |
| 489 | /modules/statssales/vendor/composer/autoload_real.php |
| 490 | /modules/statssales/vendor/composer/platform_check.php |
| 491 | /modules/statssales/vendor/composer/autoload_static.php |
| 492 | /modules/statssearch/vendor/autoload.php |
| 493 | /modules/statssearch/vendor/composer/autoload_real.php |
| 494 | /modules/statssearch/vendor/composer/platform_check.php |
| 495 | /modules/statssearch/vendor/composer/autoload_static.php |
| 496 | /modules/statsstock/vendor/autoload.php |
| 497 | /modules/statsstock/vendor/composer/autoload_real.php |
| 498 | /modules/statsstock/vendor/composer/platform_check.php |
| 499 | /modules/statsstock/vendor/composer/autoload_static.php |
| 500 | /modules/psgdpr/vendor/autoload.php |
| 501 | /modules/psgdpr/vendor/composer/autoload_real.php |
| 502 | /modules/psgdpr/vendor/composer/autoload_static.php |
| 503 | /modules/ps_facetedsearch/vendor/autoload.php |
| 504 | /modules/ps_facetedsearch/vendor/composer/autoload_real.php |
| 505 | /modules/ps_facetedsearch/vendor/composer/platform_check.php |
| 506 | /modules/ps_facetedsearch/vendor/composer/autoload_static.php |
| 507 | /modules/iqitsociallogin/vendor/autoload.php |
| 508 | /modules/iqitsociallogin/vendor/composer/autoload_real.php |
| 509 | /modules/iqitsociallogin/vendor/composer/platform_check.php |
| 510 | /modules/iqitsociallogin/vendor/composer/autoload_static.php |
| 511 | /modules/ps_emailalerts/vendor/autoload.php |
| 512 | /modules/ps_emailalerts/vendor/composer/autoload_real.php |
| 513 | /modules/ps_emailalerts/vendor/composer/autoload_static.php |
| 514 | /modules/ps_googleanalytics/vendor/autoload.php |
| 515 | /modules/ps_googleanalytics/vendor/composer/autoload_real.php |
| 516 | /modules/ps_googleanalytics/vendor/composer/platform_check.php |
| 517 | /modules/ps_googleanalytics/vendor/composer/autoload_static.php |
| 518 | /modules/ph_simpleblog/vendor/autoload.php |
| 519 | /modules/ph_simpleblog/vendor/composer/autoload_real.php |
| 520 | /modules/ph_simpleblog/vendor/composer/platform_check.php |
| 521 | /modules/ph_simpleblog/vendor/composer/autoload_static.php |
| 522 | /modules/autoupgrade/vendor/autoload.php |
| 523 | /modules/autoupgrade/vendor/composer/autoload_real.php |
| 524 | /modules/autoupgrade/vendor/composer/autoload_static.php |
| 525 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php |
| 526 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php |
| 527 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php |
| 528 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php |
| 529 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php |
| 530 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php |
| 531 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php |
| 532 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php |
| 533 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php |
| 534 | /modules/iqitproductflags/vendor/autoload.php |
| 535 | /modules/iqitproductflags/vendor/composer/autoload_real.php |
| 536 | /modules/iqitproductflags/vendor/composer/platform_check.php |
| 537 | /modules/iqitproductflags/vendor/composer/autoload_static.php |
| 538 | /modules/iqitproductvariants/vendor/autoload.php |
| 539 | /modules/iqitproductvariants/vendor/composer/autoload_real.php |
| 540 | /modules/iqitproductvariants/vendor/composer/autoload_static.php |
| 541 | /src/Core/Hook/HookModuleFilter.php |
| 542 | /src/Core/Hook/HookModuleFilterInterface.php |
| 543 | /modules/ph_simpleblog/ph_simpleblog.php |
| 544 | /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php |
| 545 | /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php |
| 546 | /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php |
| 547 | /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php |
| 548 | /modules/ph_simpleblog/models/SimpleBlogCategory.php |
| 549 | /modules/ph_simpleblog/models/SimpleBlogPost.php |
| 550 | /modules/ph_simpleblog/models/SimpleBlogPostType.php |
| 551 | /modules/ph_simpleblog/models/SimpleBlogPostImage.php |
| 552 | /modules/ph_simpleblog/models/SimpleBlogTag.php |
| 553 | /modules/ph_simpleblog/models/SimpleBlogComment.php |
| 554 | /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php |
| 555 | /modules/ph_simpleblog/classes/SimpleBlogHelper.php |
| 556 | /modules/ph_simpleblog/classes/BlogPostsFinder.php |
| 557 | /modules/ph_simpleblog/controllers/front/default_list.php |
| 558 | /classes/controller/ModuleFrontController.php |
| 559 | /override/classes/controller/FrontController.php |
| 560 | /classes/controller/FrontController.php |
| 561 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php |
| 562 | /vendor/smarty/smarty/libs/sysplugins/smarty_data.php |
| 563 | /classes/Translate.php |
| 564 | /modules/ph_simpleblog/translations/es.php |
| 565 | /src/PrestaShopBundle/Translation/TranslatorComponent.php |
| 566 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php |
| 567 | /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php |
| 568 | /vendor/symfony/contracts/Translation/LocaleAwareInterface.php |
| 569 | /vendor/symfony/contracts/Translation/TranslatorInterface.php |
| 570 | /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php |
| 571 | /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php |
| 572 | /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php |
| 573 | /src/PrestaShopBundle/Translation/TranslatorInterface.php |
| 574 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php |
| 575 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php |
| 576 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php |
| 577 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php |
| 578 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php |
| 579 | /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php |
| 580 | /vendor/symfony/contracts/Translation/TranslatorTrait.php |
| 581 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php |
| 582 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php |
| 583 | /var/cache/dev/translations/catalogue.es-ES.NXhscRe.php |
| 584 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php |
| 585 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php |
| 586 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php |
| 587 | /controllers/front/listing/CategoryController.php |
| 588 | /classes/controller/ProductListingFrontController.php |
| 589 | /classes/controller/ProductPresentingFrontController.php |
| 590 | /src/Adapter/Presenter/Object/ObjectPresenter.php |
| 591 | /src/Adapter/Presenter/PresenterInterface.php |
| 592 | /src/Adapter/Presenter/Cart/CartPresenter.php |
| 593 | /src/Adapter/Image/ImageRetriever.php |
| 594 | /classes/tax/TaxConfiguration.php |
| 595 | /classes/Smarty/TemplateFinder.php |
| 596 | /classes/assets/StylesheetManager.php |
| 597 | /classes/assets/AbstractAssetManager.php |
| 598 | /src/Adapter/Assets/AssetUrlGeneratorTrait.php |
| 599 | /classes/assets/JavascriptManager.php |
| 600 | /classes/assets/CccReducer.php |
| 601 | /modules/iqitthemeeditor/iqitthemeeditor.php |
| 602 | /modules/iqitthemeeditor/src/IqitSmartyModifiers.php |
| 603 | /modules/iqitthemeeditor/translations/es.php |
| 604 | /classes/Category.php |
| 605 | /classes/webservice/WebserviceRequest.php |
| 606 | /src/Core/Localization/Locale/Repository.php |
| 607 | /src/Core/Localization/Locale/RepositoryInterface.php |
| 608 | /src/Core/Localization/CLDR/LocaleRepository.php |
| 609 | /src/Core/Localization/CLDR/LocaleDataSource.php |
| 610 | /src/Core/Localization/CLDR/DataLayer/LocaleCache.php |
| 611 | /src/Core/Data/Layer/AbstractDataLayer.php |
| 612 | /src/Core/Localization/CLDR/LocaleDataLayerInterface.php |
| 613 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php |
| 614 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php |
| 615 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php |
| 616 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php |
| 617 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php |
| 618 | /vendor/symfony/contracts/Cache/CacheTrait.php |
| 619 | /vendor/psr/cache/src/InvalidArgumentException.php |
| 620 | /vendor/psr/cache/src/CacheException.php |
| 621 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php |
| 622 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php |
| 623 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php |
| 624 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php |
| 625 | /src/Core/Localization/CLDR/DataLayer/LocaleReference.php |
| 626 | /src/Core/Localization/CLDR/Reader.php |
| 627 | /src/Core/Localization/CLDR/ReaderInterface.php |
| 628 | /src/Core/Localization/Currency/Repository.php |
| 629 | /src/Core/Localization/Currency/RepositoryInterface.php |
| 630 | /src/Core/Localization/Currency/CurrencyDataSource.php |
| 631 | /src/Core/Localization/Currency/DataSourceInterface.php |
| 632 | /src/Core/Localization/Currency/DataLayer/CurrencyCache.php |
| 633 | /src/Core/Localization/Currency/CurrencyDataLayerInterface.php |
| 634 | /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php |
| 635 | /src/Adapter/Currency/CurrencyDataProvider.php |
| 636 | /src/Core/Currency/CurrencyDataProviderInterface.php |
| 637 | /src/Adapter/LegacyContext.php |
| 638 | /src/Adapter/Tools.php |
| 639 | /src/Core/Localization/Currency/DataLayer/CurrencyReference.php |
| 640 | /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php |
| 641 | /vendor/prestashop/decimal/src/Operation/Rounding.php |
| 642 | /src/Core/Localization/Locale.php |
| 643 | /src/Core/Localization/LocaleInterface.php |
| 644 | /src/Core/Localization/Specification/Price.php |
| 645 | /src/Core/Localization/Specification/Number.php |
| 646 | /src/Core/Localization/Specification/NumberInterface.php |
| 647 | /src/Core/Localization/Specification/Factory.php |
| 648 | /src/Core/Localization/CLDR/LocaleData.php |
| 649 | /src/Core/Localization/CLDR/NumberSymbolsData.php |
| 650 | /src/Core/Localization/CLDR/CurrencyData.php |
| 651 | /src/Core/Localization/CLDR/Locale.php |
| 652 | /src/Core/Localization/CLDR/LocaleInterface.php |
| 653 | /src/Core/Localization/Specification/NumberSymbolList.php |
| 654 | /classes/Currency.php |
| 655 | /src/Core/Localization/Currency/LocalizedCurrencyId.php |
| 656 | /src/Core/Localization/Currency/CurrencyData.php |
| 657 | /src/Core/Localization/Currency/CurrencyCollection.php |
| 658 | /src/Core/Localization/Currency.php |
| 659 | /src/Core/Localization/CurrencyInterface.php |
| 660 | /src/Core/Localization/Specification/NumberCollection.php |
| 661 | /src/Core/Localization/Number/Formatter.php |
| 662 | /override/classes/Cart.php |
| 663 | /classes/Cart.php |
| 664 | /src/Adapter/AddressFactory.php |
| 665 | /override/classes/CartRule.php |
| 666 | /classes/CartRule.php |
| 667 | /classes/Product.php |
| 668 | /src/Core/Domain/Product/ValueObject/RedirectType.php |
| 669 | /src/Core/Util/DateTime/DateTime.php |
| 670 | /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php |
| 671 | /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php |
| 672 | /src/Core/Domain/Product/ValueObject/ProductType.php |
| 673 | /src/Core/Domain/Product/ValueObject/Reference.php |
| 674 | /src/Core/Domain/Product/ValueObject/Ean13.php |
| 675 | /src/Core/Domain/Product/ValueObject/Isbn.php |
| 676 | /src/Core/Domain/Product/ValueObject/Upc.php |
| 677 | /src/Core/Domain/Product/ProductSettings.php |
| 678 | /src/Core/Domain/Shop/ValueObject/ShopId.php |
| 679 | /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php |
| 680 | /modules/ps_emailsubscription/ps_emailsubscription.php |
| 681 | /src/Core/Module/WidgetInterface.php |
| 682 | /src/PrestaShopBundle/Translation/DomainNormalizer.php |
| 683 | /classes/Media.php |
| 684 | /modules/ps_emailalerts/ps_emailalerts.php |
| 685 | /modules/ps_emailalerts/MailAlert.php |
| 686 | /modules/iqitproductvariants/iqitproductvariants.php |
| 687 | /src/Adapter/Localization/LegacyTranslator.php |
| 688 | /src/Adapter/Presenter/Cart/CartLazyArray.php |
| 689 | /src/Adapter/Presenter/AbstractLazyArray.php |
| 690 | /src/Adapter/Product/PriceFormatter.php |
| 691 | /src/Core/Util/Inflector.php |
| 692 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php |
| 693 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php |
| 694 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php |
| 695 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php |
| 696 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php |
| 697 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php |
| 698 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php |
| 699 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php |
| 700 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php |
| 701 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php |
| 702 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php |
| 703 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php |
| 704 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php |
| 705 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php |
| 706 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php |
| 707 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php |
| 708 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php |
| 709 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php |
| 710 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php |
| 711 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php |
| 712 | /classes/Gender.php |
| 713 | /classes/Risk.php |
| 714 | /classes/Meta.php |
| 715 | /modules/revsliderprestashop/revsliderprestashop.php |
| 716 | /modules/revsliderprestashop/rev-loader.php |
| 717 | /modules/revsliderprestashop/includes/revslider_db.class.php |
| 718 | /modules/revsliderprestashop/includes/data.class.php |
| 719 | /modules/revsliderprestashop/includes/functions.class.php |
| 720 | /modules/revsliderprestashop/includes/em-integration.class.php |
| 721 | /modules/revsliderprestashop/includes/cssparser.class.php |
| 722 | /modules/revsliderprestashop/includes/woocommerce.class.php |
| 723 | /modules/revsliderprestashop/includes/wpml.class.php |
| 724 | /modules/revsliderprestashop/includes/colorpicker.class.php |
| 725 | /modules/revsliderprestashop/includes/navigation.class.php |
| 726 | /modules/revsliderprestashop/includes/object-library.class.php |
| 727 | /modules/revsliderprestashop/admin/includes/loadbalancer.class.php |
| 728 | /modules/revsliderprestashop/admin/includes/plugin-update.class.php |
| 729 | /modules/revsliderprestashop/includes/extension.class.php |
| 730 | /modules/revsliderprestashop/includes/favorite.class.php |
| 731 | /modules/revsliderprestashop/includes/aq-resizer.class.php |
| 732 | /modules/revsliderprestashop/includes/external-sources.class.php |
| 733 | /modules/revsliderprestashop/includes/page-template.class.php |
| 734 | /modules/revsliderprestashop/includes/slider.class.php |
| 735 | /modules/revsliderprestashop/includes/slide.class.php |
| 736 | /modules/revsliderprestashop/includes/output.class.php |
| 737 | /modules/revsliderprestashop/public/revslider-front.class.php |
| 738 | /modules/revsliderprestashop/includes/backwards.php |
| 739 | /modules/revsliderprestashop/admin/includes/class-pclzip.php |
| 740 | /modules/revsliderprestashop/admin/includes/license.class.php |
| 741 | /modules/revsliderprestashop/admin/includes/addons.class.php |
| 742 | /modules/revsliderprestashop/admin/includes/template.class.php |
| 743 | /modules/revsliderprestashop/admin/includes/functions-admin.class.php |
| 744 | /modules/revsliderprestashop/admin/includes/folder.class.php |
| 745 | /modules/revsliderprestashop/admin/includes/import.class.php |
| 746 | /modules/revsliderprestashop/admin/includes/export.class.php |
| 747 | /modules/revsliderprestashop/admin/includes/export-html.class.php |
| 748 | /modules/revsliderprestashop/admin/includes/newsletter.class.php |
| 749 | /modules/revsliderprestashop/admin/revslider-admin.class.php |
| 750 | /modules/revsliderprestashop/includes/update.class.php |
| 751 | /modules/revsliderprestashop/includes/resize-imag.php |
| 752 | /modules/revsliderprestashop/translations/es.php |
| 753 | /classes/Address.php |
| 754 | /classes/ImageType.php |
| 755 | /classes/State.php |
| 756 | /src/Core/Security/PasswordPolicyConfiguration.php |
| 757 | /src/Core/Configuration/DataConfigurationInterface.php |
| 758 | /src/Core/Filter/FrontEndObject/MainFilter.php |
| 759 | /src/Core/Filter/FilterInterface.php |
| 760 | /src/Core/Filter/FrontEndObject/CartFilter.php |
| 761 | /src/Core/Filter/HashMapWhitelistFilter.php |
| 762 | /src/Core/Filter/CollectionFilter.php |
| 763 | /src/Core/Filter/FrontEndObject/ProductFilter.php |
| 764 | /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php |
| 765 | /src/Core/Filter/FrontEndObject/CustomerFilter.php |
| 766 | /src/Core/Filter/FrontEndObject/ShopFilter.php |
| 767 | /src/Core/Filter/FrontEndObject/ConfigurationFilter.php |
| 768 | /modules/productcomments/productcomments.php |
| 769 | /modules/ps_shoppingcart/ps_shoppingcart.php |
| 770 | /modules/iqitcontactpage/iqitcontactpage.php |
| 771 | /modules/iqitcontactpage/translations/es.php |
| 772 | /modules/iqitcookielaw/iqitcookielaw.php |
| 773 | /modules/iqitcookielaw/translations/es.php |
| 774 | /modules/iqitcountdown/iqitcountdown.php |
| 775 | /modules/iqitcountdown/translations/es.php |
| 776 | /modules/iqitsociallogin/iqitsociallogin.php |
| 777 | /modules/iqitsociallogin/translations/es.php |
| 778 | /modules/ps_googleanalytics/ps_googleanalytics.php |
| 779 | /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php |
| 780 | /modules/ps_googleanalytics/classes/Hook/HookInterface.php |
| 781 | /classes/Smarty/SmartyDevTemplate.php |
| 782 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php |
| 783 | /var/cache/dev/smarty/compile/warehouse/7f/93/a7/7f93a70bcc26a0e15d5a8f0ad7b21b4b42ad15c2_2.file.ps_googleanalytics.tpl.php |
| 784 | /vendor/smarty/smarty/libs/plugins/modifier.escape.php |
| 785 | /classes/assets/PrestashopAssetsLibraries.php |
| 786 | /modules/iqitsizecharts/iqitsizecharts.php |
| 787 | /modules/iqitsizecharts/src/IqitSizeCharts.php |
| 788 | /modules/iqitsizecharts/translations/es.php |
| 789 | /modules/iqitwishlist/iqitwishlist.php |
| 790 | /modules/iqitwishlist/src/IqitWishlistProduct.php |
| 791 | /modules/iqitwishlist/translations/es.php |
| 792 | /modules/iqitreviews/iqitreviews.php |
| 793 | /modules/iqitreviews/src/IqitProductReview.php |
| 794 | /modules/iqitreviews/translations/es.php |
| 795 | /modules/iqitpopup/iqitpopup.php |
| 796 | /modules/iqitpopup/translations/es.php |
| 797 | /modules/iqitmegamenu/iqitmegamenu.php |
| 798 | /modules/iqitmegamenu/models/IqitMenuTab.php |
| 799 | /modules/iqitmegamenu/models/IqitMenuHtml.php |
| 800 | /modules/iqitmegamenu/models/IqitMenuLinks.php |
| 801 | /modules/iqitmegamenu/translations/es.php |
| 802 | /modules/iqitcompare/iqitcompare.php |
| 803 | /modules/iqitcompare/translations/es.php |
| 804 | /modules/iqitelementor/iqitelementor.php |
| 805 | /modules/iqitelementor/src/IqitElementorLanding.php |
| 806 | /modules/iqitelementor/src/IqitElementorTemplate.php |
| 807 | /modules/iqitelementor/src/IqitElementorProduct.php |
| 808 | /modules/iqitelementor/src/IqitElementorCategory.php |
| 809 | /modules/iqitelementor/src/IqitElementorContent.php |
| 810 | /modules/iqitelementor/src/iqitElementorWpHelper.php |
| 811 | /modules/iqitelementor/includes/plugin-elementor.php |
| 812 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php |
| 813 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php |
| 814 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php |
| 815 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php |
| 816 | /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php |
| 817 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php |
| 818 | /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php |
| 819 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php |
| 820 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php |
| 821 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php |
| 822 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php |
| 823 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php |
| 824 | /modules/iqitelementor/translations/es.php |
| 825 | /modules/iqitextendedproduct/iqitextendedproduct.php |
| 826 | /modules/iqitextendedproduct/src/IqitThreeSixty.php |
| 827 | /modules/iqitextendedproduct/src/IqitProductVideo.php |
| 828 | /modules/iqitextendedproduct/translations/es.php |
| 829 | /modules/iqitfreedeliverycount/iqitfreedeliverycount.php |
| 830 | /modules/iqitfreedeliverycount/translations/es.php |
| 831 | /src/Core/Product/Search/ProductSearchContext.php |
| 832 | /src/Core/Product/Search/ProductSearchQuery.php |
| 833 | /src/Core/Product/Search/SortOrder.php |
| 834 | /modules/ps_facetedsearch/ps_facetedsearch.php |
| 835 | /modules/ps_facetedsearch/src/HookDispatcher.php |
| 836 | /modules/ps_facetedsearch/src/Hook/Attribute.php |
| 837 | /modules/ps_facetedsearch/src/Hook/AbstractHook.php |
| 838 | /modules/ps_facetedsearch/src/Hook/AttributeGroup.php |
| 839 | /modules/ps_facetedsearch/src/Hook/Category.php |
| 840 | /modules/ps_facetedsearch/src/Hook/Configuration.php |
| 841 | /modules/ps_facetedsearch/src/Hook/Design.php |
| 842 | /modules/ps_facetedsearch/src/Hook/Feature.php |
| 843 | /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php |
| 844 | /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php |
| 845 | /modules/ps_facetedsearch/src/Hook/FeatureValue.php |
| 846 | /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php |
| 847 | /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php |
| 848 | /modules/ps_facetedsearch/src/Hook/Product.php |
| 849 | /modules/ps_facetedsearch/src/Hook/ProductSearch.php |
| 850 | /modules/ps_facetedsearch/src/Hook/SpecificPrice.php |
| 851 | /modules/ps_facetedsearch/src/Filters/Provider.php |
| 852 | /modules/ps_facetedsearch/src/URLSerializer.php |
| 853 | /modules/ps_facetedsearch/src/Filters/DataAccessor.php |
| 854 | /modules/ps_facetedsearch/src/Product/SearchProvider.php |
| 855 | /src/Core/Product/Search/FacetsRendererInterface.php |
| 856 | /src/Core/Product/Search/ProductSearchProviderInterface.php |
| 857 | /modules/ps_facetedsearch/src/Filters/Converter.php |
| 858 | /modules/ps_facetedsearch/src/Product/SearchFactory.php |
| 859 | /src/Core/Product/Search/ProductSearchResult.php |
| 860 | /classes/Combination.php |
| 861 | /classes/Manufacturer.php |
| 862 | /src/Core/Util/String/StringModifier.php |
| 863 | /src/Core/Util/String/StringModifierInterface.php |
| 864 | /modules/ps_facetedsearch/src/Product/Search.php |
| 865 | /modules/ps_facetedsearch/src/Adapter/MySQL.php |
| 866 | /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php |
| 867 | /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php |
| 868 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php |
| 869 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php |
| 870 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php |
| 871 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php |
| 872 | /modules/ps_facetedsearch/src/Filters/Products.php |
| 873 | /classes/stock/StockAvailable.php |
| 874 | /modules/ps_facetedsearch/src/Filters/Block.php |
| 875 | /src/Core/Product/Search/Facet.php |
| 876 | /src/Core/Product/Search/Filter.php |
| 877 | /vendor/prestashop/decimal/src/DecimalNumber.php |
| 878 | /vendor/prestashop/decimal/src/Builder.php |
| 879 | /src/Core/Product/Search/FacetCollection.php |
| 880 | /classes/ProductAssembler.php |
| 881 | /classes/tax/Tax.php |
| 882 | /classes/SpecificPrice.php |
| 883 | /classes/tax/TaxManagerFactory.php |
| 884 | /classes/tax/TaxRulesTaxManager.php |
| 885 | /classes/tax/TaxManagerInterface.php |
| 886 | /classes/tax/TaxCalculator.php |
| 887 | /classes/GroupReduction.php |
| 888 | /src/Core/Localization/CLDR/ComputingPrecision.php |
| 889 | /src/Core/Localization/CLDR/ComputingPrecisionInterface.php |
| 890 | /classes/Pack.php |
| 891 | /classes/order/Order.php |
| 892 | /classes/Feature.php |
| 893 | /classes/ProductPresenterFactory.php |
| 894 | /src/Adapter/Presenter/Product/ProductListingPresenter.php |
| 895 | /src/Adapter/Presenter/Product/ProductPresenter.php |
| 896 | /src/Adapter/Product/ProductColorsRetriever.php |
| 897 | /src/Adapter/HookManager.php |
| 898 | /src/Core/Product/ProductPresentationSettings.php |
| 899 | /src/Adapter/Presenter/Product/ProductListingLazyArray.php |
| 900 | /src/Adapter/Presenter/Product/ProductLazyArray.php |
| 901 | /classes/Image.php |
| 902 | /src/Core/Image/ImageFormatConfiguration.php |
| 903 | /src/Core/Image/ImageFormatConfigurationInterface.php |
| 904 | /classes/FeatureFlag.php |
| 905 | /src/Core/FeatureFlag/FeatureFlagSettings.php |
| 906 | /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php |
| 907 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php |
| 908 | /vendor/smarty/smarty/libs/plugins/modifier.count.php |
| 909 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php |
| 910 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php |
| 911 | /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php |
| 912 | /src/Core/Product/Search/Pagination.php |
| 913 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/a2/ac/10a2acb40a62faa7d4acf2ff79326cb9143364b9_2.file.category.tpl.php |
| 914 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php |
| 915 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/7b/44/3b7b442e5be09f725564779ed89a7b73454120cc_2.file.product-list.tpl.php |
| 916 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7b/05/e6/7b05e63eca4eeeca1407af0182fcc5f72eca6296_2.file.layout-left-column.tpl.php |
| 917 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/dd/6f/fedd6f2f1c5383ca8f7a88001e645ec51798686f_2.file.layout-both-columns.tpl.php |
| 918 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9f/7e/4a/9f7e4a2a31953c1ffd9af92c83bd91c1f3cd2c35_2.file.helpers.tpl.php |
| 919 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php |
| 920 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/44/bf/b0/44bfb034c1f795379c422b7f1f9e16fbdd438c93_2.file.head.tpl.php |
| 921 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/74/6f/a3/746fa3dd2b21e5f8274bb1f50aedff4595bb552e_2.file.head-jsonld.tpl.php |
| 922 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/8d/80/d08d80bb870efd73dd55124817cbf5d770e7f7b2_2.file.product-list-jsonld.tpl.php |
| 923 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/56/86/bf/5686bf9c07020fd395790a361d8976132a2fc4be_2.file.pagination-seo.tpl.php |
| 924 | /vendor/smarty/smarty/libs/plugins/modifier.replace.php |
| 925 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/93/e8/ed/93e8edeadb416f4f6abcf2d2b76fb0f54d0eba3d_2.file.stylesheets.tpl.php |
| 926 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/af/76/c2af76b01726147ed1ded7543d0fd920339756bf_2.file.javascript.tpl.php |
| 927 | /classes/ProductDownload.php |
| 928 | /src/Core/Cart/Calculator.php |
| 929 | /src/Core/Cart/CartRowCollection.php |
| 930 | /src/Core/Cart/Fees.php |
| 931 | /src/Core/Cart/AmountImmutable.php |
| 932 | /src/Core/Cart/CartRuleCollection.php |
| 933 | /src/Core/Cart/CartRuleCalculator.php |
| 934 | /src/Adapter/Product/PriceCalculator.php |
| 935 | /src/Core/Cart/CartRow.php |
| 936 | /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php |
| 937 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/0d/00/3b0d00bced40dc74d264c896b3629516dca0a06b_2.file.product-activation.tpl.php |
| 938 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/2a/1d/d02a1d5aa2fc8a2b372e76425c1d49b597137881_2.file.header.tpl.php |
| 939 | /modules/iqitlinksmanager/iqitlinksmanager.php |
| 940 | /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php |
| 941 | /modules/iqitlinksmanager/src/IqitLinkBlock.php |
| 942 | /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php |
| 943 | /modules/iqitlinksmanager/translations/es.php |
| 944 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php |
| 945 | /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php |
| 946 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php |
| 947 | /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php |
| 948 | /modules/ps_languageselector/ps_languageselector.php |
| 949 | /modules/ps_currencyselector/ps_currencyselector.php |
| 950 | /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php |
| 951 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/54/66/f65466132945e631eb8304d318e35f83d75d651e_2.file.header-2.tpl.php |
| 952 | /modules/iqitsearch/iqitsearch.php |
| 953 | /modules/iqitsearch/translations/es.php |
| 954 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php |
| 955 | /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php |
| 956 | /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php |
| 957 | /modules/ps_customersignin/ps_customersignin.php |
| 958 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php |
| 959 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php |
| 960 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php |
| 961 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php |
| 962 | /var/cache/dev/smarty/compile/warehouse/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php |
| 963 | /var/cache/dev/smarty/compile/warehouse/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php |
| 964 | /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/a0/a9/c9/a0a9c936f74308bdc1809002e948b8c26b0f5101.iqitmegamenuviewstemplateshookhorizontal.tpl.php |
| 965 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/32/0c/d5/320cd56ae00cdb0df3cfaafda14dd79eef879159_2.file.mobile-header-2.tpl.php |
| 966 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php |
| 967 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php |
| 968 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php |
| 969 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/88/01/f3/8801f3aef6612da9973e6f09844670ad2455b33c_2.file.breadcrumb.tpl.php |
| 970 | /modules/iqitproductsnav/iqitproductsnav.php |
| 971 | /modules/iqitproductsnav/translations/es.php |
| 972 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/50/cf/2150cf9c7d24917c3322283d8d2a9798a55f33e1_2.file.notifications.tpl.php |
| 973 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/39/dd/35/39dd3579b0d411714a13183f74f90657d9b16218_2.file.category-header.tpl.php |
| 974 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/dc/dd/42/dcdd424ea5bdc2c731edea74e82e1b9752018d7f_2.file.products-top.tpl.php |
| 975 | /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php |
| 976 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/f8/f7/e0f8f73bf2628e2a1784900d2234f9911a72566f_2.file.sort-orders.tpl.php |
| 977 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/01/2d/6a/012d6af2272aef31c4959b70cb660dbba790eea4_2.file.pagination.tpl.php |
| 978 | /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php |
| 979 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e1/47/0e/e1470e491391572ac54700f0cafe332fed74977f_2.file.products.tpl.php |
| 980 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/df/f3/21dff30aa3f82bc080b677e35ebedc1ec9a53690_2.file.product.tpl.php |
| 981 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b2/b6/ab/b2b6ab658128da2281b45debedef04ba4285e0d8_2.file.product-miniature-1.tpl.php |
| 982 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/70/ad/8b/70ad8bf895d617e9f5f73f4ce8c2c56d5c17c215_2.file.product-miniature-thumb.tpl.php |
| 983 | /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php |
| 984 | /var/cache/dev/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php |
| 985 | /modules/iqitproductflags/iqitproductflags.php |
| 986 | /src/Adapter/ContainerFinder.php |
| 987 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php |
| 988 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php |
| 989 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php |
| 990 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php |
| 991 | /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php |
| 992 | /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php |
| 993 | /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php |
| 994 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php |
| 995 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php |
| 996 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php |
| 997 | /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php |
| 998 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php |
| 999 | /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php |
| 1000 | /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php |
| 1001 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php |
| 1002 | /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php |
| 1003 | /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php |
| 1004 | /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php |
| 1005 | /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php |
| 1006 | /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php |
| 1007 | /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php |
| 1008 | /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php |
| 1009 | /vendor/doctrine/persistence/src/Persistence/ObjectManager.php |
| 1010 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php |
| 1011 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php |
| 1012 | /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php |
| 1013 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php |
| 1014 | /vendor/doctrine/doctrine-bundle/ConnectionFactory.php |
| 1015 | /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php |
| 1016 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php |
| 1017 | /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php |
| 1018 | /vendor/doctrine/event-manager/src/EventManager.php |
| 1019 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php |
| 1020 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php |
| 1021 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php |
| 1022 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php |
| 1023 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php |
| 1024 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php |
| 1025 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php |
| 1026 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php |
| 1027 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php |
| 1028 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php |
| 1029 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php |
| 1030 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php |
| 1031 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php |
| 1032 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php |
| 1033 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php |
| 1034 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php |
| 1035 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php |
| 1036 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php |
| 1037 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php |
| 1038 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php |
| 1039 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php |
| 1040 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php |
| 1041 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php |
| 1042 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php |
| 1043 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL80Platform.php |
| 1044 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL57Platform.php |
| 1045 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php |
| 1046 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php |
| 1047 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php |
| 1048 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php |
| 1049 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php |
| 1050 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php |
| 1051 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php |
| 1052 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php |
| 1053 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php |
| 1054 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php |
| 1055 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php |
| 1056 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php |
| 1057 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php |
| 1058 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php |
| 1059 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php |
| 1060 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php |
| 1061 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php |
| 1062 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php |
| 1063 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php |
| 1064 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php |
| 1065 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php |
| 1066 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php |
| 1067 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php |
| 1068 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php |
| 1069 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php |
| 1070 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php |
| 1071 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php |
| 1072 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php |
| 1073 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php |
| 1074 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php |
| 1075 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php |
| 1076 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php |
| 1077 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php |
| 1078 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php |
| 1079 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php |
| 1080 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php |
| 1081 | /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php |
| 1082 | /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php |
| 1083 | /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php |
| 1084 | /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php |
| 1085 | /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php |
| 1086 | /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php |
| 1087 | /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php |
| 1088 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php |
| 1089 | /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php |
| 1090 | /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php |
| 1091 | /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php |
| 1092 | /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php |
| 1093 | /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php |
| 1094 | /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php |
| 1095 | /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php |
| 1096 | /vendor/doctrine/persistence/src/Persistence/Proxy.php |
| 1097 | /modules/iqitproductflags/src/Entity/IqitProductFlag.php |
| 1098 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php |
| 1099 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php |
| 1100 | /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php |
| 1101 | /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php |
| 1102 | /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php |
| 1103 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php |
| 1104 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php |
| 1105 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php |
| 1106 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php |
| 1107 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php |
| 1108 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php |
| 1109 | /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php |
| 1110 | /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php |
| 1111 | /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php |
| 1112 | /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php |
| 1113 | /src/PrestaShopBundle/Entity/Shop.php |
| 1114 | /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php |
| 1115 | /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php |
| 1116 | /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php |
| 1117 | /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php |
| 1118 | /modules/iqitproductflags/src/Repository/FlagRepository.php |
| 1119 | /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php |
| 1120 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php |
| 1121 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php |
| 1122 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php |
| 1123 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php |
| 1124 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php |
| 1125 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php |
| 1126 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php |
| 1127 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php |
| 1128 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php |
| 1129 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php |
| 1130 | /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php |
| 1131 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php |
| 1132 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php |
| 1133 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php |
| 1134 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php |
| 1135 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php |
| 1136 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php |
| 1137 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php |
| 1138 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php |
| 1139 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php |
| 1140 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php |
| 1141 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php |
| 1142 | /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php |
| 1143 | /src/PrestaShopBundle/Entity/Lang.php |
| 1144 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php |
| 1145 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php |
| 1146 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php |
| 1147 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php |
| 1148 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php |
| 1149 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php |
| 1150 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php |
| 1151 | /src/PrestaShopBundle/Entity/ShopGroup.php |
| 1152 | /src/PrestaShopBundle/Entity/ShopUrl.php |
| 1153 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php |
| 1154 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php |
| 1155 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php |
| 1156 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php |
| 1157 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php |
| 1158 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php |
| 1159 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php |
| 1160 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php |
| 1161 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php |
| 1162 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php |
| 1163 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php |
| 1164 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php |
| 1165 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php |
| 1166 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php |
| 1167 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php |
| 1168 | /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php |
| 1169 | /src/PrestaShopBundle/Entity/Translation.php |
| 1170 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php |
| 1171 | /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php |
| 1172 | /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php |
| 1173 | /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php |
| 1174 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php |
| 1175 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php |
| 1176 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php |
| 1177 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php |
| 1178 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php |
| 1179 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php |
| 1180 | /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php |
| 1181 | /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php |
| 1182 | /modules/iqitproductflags/src/Presenter/FlagPresenter.php |
| 1183 | /var/cache/dev/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php |
| 1184 | /var/cache/dev/smarty/compile/warehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php |
| 1185 | /vendor/smarty/smarty/libs/plugins/function.math.php |
| 1186 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/75/b9/97/75b997bec85704ff1d7a8fb47417253a50e7be32_2.file.product-miniature-btn.tpl.php |
| 1187 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/50/d2/88/50d288732d70e59ef94f3875a561157d73c09f9e_2.file.products-bottom.tpl.php |
| 1188 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/ce/84/ea/ce84eadc655e6b98707bc940129b94e0b7569370_2.file.category-footer.tpl.php |
| 1189 | /modules/ps_categorytree/ps_categorytree.php |
| 1190 | /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php |
| 1191 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/3a/47/3e3a47dc2c5a5d8e5e109d269aa58f1349bf3548_2.file.footer.tpl.php |
| 1192 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e6/9f/81/e69f8156b2319dff0e9edb2994d7f3cbefe774c5_2.file.footer-2.tpl.php |
| 1193 | /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php |
| 1194 | /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/6/warehouse/1d/83/01/1d8301bd7699d773c48e9ed487e5b638a51c9c67.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php |
| 1195 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/00/82/b5/0082b5f5ed9b849deb993e6b9ea0688ca3375d26_2.file.footer-copyrights-1.tpl.php |
| 1196 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e7/73/6b/e7736b26e5e94f428f828dbc3573ce171a95c436_2.file.password-policy-template.tpl.php |
| 1197 | /classes/form/CustomerLoginForm.php |
| 1198 | /classes/form/AbstractForm.php |
| 1199 | /classes/form/FormInterface.php |
| 1200 | /src/Core/Foundation/Templating/RenderableInterface.php |
| 1201 | /classes/form/CustomerLoginFormatter.php |
| 1202 | /classes/form/FormFormatterInterface.php |
| 1203 | /classes/ValidateConstraintTranslator.php |
| 1204 | /src/Core/Util/InternationalizedDomainNameConverter.php |
| 1205 | /src/Core/Foundation/Templating/RenderableProxy.php |
| 1206 | /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php |
| 1207 | /classes/form/FormField.php |
| 1208 | /var/cache/dev/smarty/compile/warehouse/f2/1e/55/f21e55894ac1dca3333e5ff490219e193d3a69c6_2.file.login-form.tpl.php |
| 1209 | /var/cache/dev/smarty/compile/warehouse/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php |
| 1210 | /var/cache/dev/smarty/compile/d2/95/88/d29588162f18c1514f5b17d42ceef7eee6820be1_2.file.form-fields.tpl.php |
| 1211 | /var/cache/dev/smarty/compile/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php |
| 1212 | /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/6/warehouse/60/1e/f4/601ef4a2f7dca2c97f8f1a899dc64be4a2331ab8.iqitsocialloginviewstemplateshookauthentication.tpl.php |
| 1213 | /var/cache/dev/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php |
| 1214 | /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/02/05/98/020598f14f8b3a756a608f01492a41ebd60e5afd.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php |
| 1215 | /modules/statsdata/statsdata.php |
| 1216 | /classes/Connection.php |
| 1217 | /classes/ConnectionsSource.php |
| 1218 | /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php |
| 1219 | /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php |
| 1220 | /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php |
| 1221 | /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php |
| 1222 | /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php |
| 1223 | /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php |
| 1224 | /var/cache/dev/smarty/compile/warehouse/0b/04/d5/0b04d5d296cc40e94fc50a82355434090632a0d7_2.file.ga_tag.tpl.php |