FACIAL

Cosmética facial 

Cuida tu piel con nuestra dermocosmética facial

Mostrando 1-31 de 31 artículo(s)
Producto añadido
Producto añadido a Comparar

Este sitio web utiliza cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Para dar su consentimiento sobre su uso pulse el botón Acepto.

Load Time 663.076 ms
Querying Time 271 ms
Queries 674
Memory Peak Usage 63.4 Mb
Included Files 1226 files - 12.70 Mb
PrestaShop Cache - Mb
Global vars 0.05 Mb
PrestaShop Version 8.2.7
PHP Version 8.4.10
MySQL Version 8.0.45-36
Memory Limit 512M
Max Execution Time 165s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 89.456 ms 89.456 ms 18.40 Mb 19.6 Mb
__construct 0.011 ms 89.467 ms - Mb 19.6 Mb
init 32.607 ms 122.074 ms 5.29 Mb 24.7 Mb
checkAccess 0.001 ms 122.075 ms - Mb 24.7 Mb
setMedia 3.560 ms 125.635 ms 0.79 Mb 24.7 Mb
postProcess 0.001 ms 125.636 ms - Mb 24.7 Mb
initHeader 0.001 ms 125.637 ms - Mb 24.7 Mb
initContent 343.407 ms 469.044 ms 23.20 Mb 47.7 Mb
initFooter 0.002 ms 469.046 ms - Mb 47.7 Mb
display 194.030 ms 663.076 ms 14.66 Mb 63.4 Mb
Hook Time Memory Usage
DisplayProductCampagains 86.504 ms 6.43 Mb
displayProductListReviews 19.609 ms 1.22 Mb
displayProductListFunctionalButtons 11.791 ms 0.08 Mb
DisplayBeforeBodyClosingTag 5.472 ms 0.32 Mb
displayBeforeBodyClosingTag 5.426 ms 0.81 Mb
displayLeftColumn 3.700 ms 0.23 Mb
displayNav2 2.901 ms 0.17 Mb
DisplayHeader 2.318 ms 0.18 Mb
renderWidget 2.038 ms 0.20 Mb
displayNav1 1.916 ms 0.21 Mb
displayCategoryElementor 1.706 ms 0.08 Mb
ProductSearchProvider 1.236 ms 0.20 Mb
displayFooter 1.101 ms 0.10 Mb
displayTop 1.051 ms 0.12 Mb
displayMainMenu 1.029 ms 0.20 Mb
displayCustomerLoginFormAfter 0.904 ms 0.07 Mb
ActionFrontControllerSetMedia 0.671 ms 0.13 Mb
displayAfterBreadcrumb 0.643 ms 0.04 Mb
IsJustElementor 0.382 ms 0.02 Mb
DisplayLeftColumn 0.239 ms 0.07 Mb
OverrideLayoutTemplate 0.035 ms - Mb
displayVerticalMenu 0.009 ms - Mb
ModuleRoutes 0.006 ms - Mb
ActionDispatcher 0.005 ms - Mb
ActionProductSearchAfter 0.004 ms - Mb
25 hook(s) 150.695 ms 10.89 Mb
Module Time Memory Usage
ph_simpleblog 11.218 ms 3.30 Mb
iqitthemeeditor 1.736 ms 0.54 Mb
ps_emailsubscription 1.702 ms 0.37 Mb
ps_emailalerts 1.193 ms 0.29 Mb
iqitproductvariants 0.313 ms 0.04 Mb
revsliderprestashop 28.624 ms 7.98 Mb
productcomments 0.895 ms 0.28 Mb
ps_shoppingcart 1.299 ms 0.17 Mb
iqitcontactpage 1.237 ms 0.12 Mb
iqitcookielaw 1.171 ms 0.11 Mb
iqitcountdown 0.196 ms 0.03 Mb
iqitsociallogin 1.277 ms 0.14 Mb
ps_googleanalytics 3.944 ms 0.36 Mb
iqitsizecharts 0.949 ms 0.26 Mb
iqitwishlist 11.802 ms 0.94 Mb
iqitreviews 20.139 ms 1.33 Mb
iqitpopup 1.145 ms 0.15 Mb
iqitmegamenu 4.821 ms 1.06 Mb
iqitcompare 6.506 ms 0.16 Mb
iqitelementor 6.147 ms 1.07 Mb
iqitextendedproduct 0.744 ms 0.16 Mb
iqitfreedeliverycount 0.333 ms 0.06 Mb
ps_facetedsearch 4.669 ms 0.91 Mb
iqitlinksmanager 3.172 ms 0.38 Mb
ps_languageselector 0.879 ms 0.07 Mb
ps_currencyselector 0.910 ms 0.07 Mb
iqitsearch 1.341 ms 0.12 Mb
ps_customersignin 0.132 ms 0.03 Mb
iqitproductsnav 0.866 ms 0.08 Mb
iqitproductflags 86.901 ms 6.56 Mb
ps_categorytree 4.254 ms 0.29 Mb
statsdata 2.907 ms 0.16 Mb
32 module(s) 213.422 ms 27.58 Mb

Stopwatch SQL - 674 queries

# Query Time (ms) Rows Filesort Group By Location
83
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p GROUP BY p.id_manufacturer
14.168 ms 39950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `och438configuration` c
LEFT JOIN `och438configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
3.580 ms 1327 /classes/Configuration.php:180
92
REPLACE INTO och438layered_filter_block (hash, data) VALUES ("fcef5de302327caede79853487535db9", "a:1:{s:7:\"filters\";a:4:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:9:{i:26;a:2:{s:4:\"name\";s:11:\"LIMPIADORES\";s:3:\"nbr\";s:1:\"2\";}i:29;a:2:{s:4:\"name\";s:5:\"SERUM\";s:3:\"nbr\";s:1:\"5\";}i:33;a:2:{s:4:\"name\";s:16:\"CONTORNO DE OJOS\";s:3:\"nbr\";s:1:\"1\";}i:40;a:2:{s:4:\"name\";s:11:\"EXFOLIANTES\";s:3:\"nbr\";s:1:\"1\";}i:41;a:2:{s:4:\"name\";s:11:\"MASCARILLAS\";s:3:\"nbr\";s:2:\"13\";}i:42;a:2:{s:4:\"name\";s:8:\"TÓNICOS\";s:3:\"nbr\";s:1:\"2\";}i:44;a:2:{s:4:\"name\";s:6:\"CREMAS\";s:3:\"nbr\";s:1:\"3\";}i:130;a:2:{s:4:\"name\";s:17:\"COSMETICA COREANA\";s:3:\"nbr\";s:2:\"31\";}i:131;a:2:{s:4:\"name\";s:16:\"POTENCIA TU GLOW\";s:3:\"nbr\";s:2:\"12\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:38:{i:3;a:2:{s:4:\"name\";s:5:\"ISDIN\";s:3:\"nbr\";s:1:\"8\";}i:5;a:2:{s:4:\"name\";s:14:\"Cantabria Labs\";s:3:\"nbr\";s:1:\"1\";}i:6;a:2:{s:4:\"name\";s:6:\"Cerave\";s:3:\"nbr\";s:2:\"22\";}i:7;a:2:{s:4:\"name\";s:3:\"SVR\";s:3:\"nbr\";s:1:\"1\";}i:11;a:2:{s:4:\"name\";s:14:\"LA ROCHE POSAY\";s:3:\"nbr\";s:2:\"19\";}i:12;a:2:{s:4:\"name\";s:11:\"IFCANTABRIA\";s:3:\"nbr\";s:2:\"54\";}i:13;a:2:{s:4:\"name\";s:15:\"LAB SVR ESPAÑA\";s:3:\"nbr\";s:2:\"68\";}i:14;a:2:{s:4:\"name\";s:13:\"SKINCEUTICALS\";s:3:\"nbr\";s:2:\"32\";}i:22;a:2:{s:4:\"name\";s:18:\"LETI PHARMA S.L.U.\";s:3:\"nbr\";s:1:\"3\";}i:57;a:2:{s:4:\"name\";s:11:\"ARTURO ALBA\";s:3:\"nbr\";s:2:\"23\";}i:58;a:2:{s:4:\"name\";s:8:\"ERBORIAN\";s:3:\"nbr\";s:2:\"20\";}i:59;a:2:{s:4:\"name\";s:13:\"Moncho moreno\";s:3:\"nbr\";s:1:\"1\";}i:61;a:2:{s:4:\"name\";s:3:\"TWO\";s:3:\"nbr\";s:2:\"20\";}i:62;a:2:{s:4:\"name\";s:15:\"IVB Welness lab\";s:3:\"nbr\";s:1:\"1\";}i:67;a:2:{s:4:\"name\";s:22:\"L´occitane (erborian)\";s:3:\"nbr\";s:2:\"58\";}i:68;a:2:{s:4:\"name\";s:18:\"GEMA HERRERIA S.LU\";s:3:\"nbr\";s:2:\"33\";}i:70;a:2:{s:4:\"name\";s:19:\"MIIN COSMETICS S.L.\";s:3:\"nbr\";s:2:\"11\";}i:87;a:2:{s:4:\"name\";s:7:\"OZOAQUA\";s:3:\"nbr\";s:1:\"1\";}i:93;a:2:{s:4:\"name\";s:16:\"BEAUTY OF JOSEON\";s:3:\"nbr\";s:2:\"24\";}i:94;a:2:{s:4:\"name\";s:6:\"TOCOBO\";s:3:\"nbr\";s:1:\"9\";}i:99;a:3:{s:4:\"name\";s:6:\"BIODES\";s:3:\"nbr\";s:1:\"5\";s:7:\"checked\";b:1;}i:100;a:2:{s:4:\"name\";s:12:\"CANTABRIA PH\";s:3:\"nbr\";s:1:\"3\";}i:112;a:2:{s:4:\"name\";s:6:\"d\'Alba\";s:3:\"nbr\";s:1:\"6\";}i:113;a:2:{s:4:\"name\";s:15:\"haruharu wonder\";s:3:\"nbr\";s:1:\"2\";}i:114;a:2:{s:4:\"name\";s:8:\"Dr.Jart+\";s:3:\"nbr\";s:1:\"3\";}i:115;a:3:{s:4:\"name\";s:8:\"MEDICUBE\";s:3:\"nbr\";s:2:\"23\";s:7:\"checked\";b:1;}i:116;a:2:{s:4:\"name\";s:32:\"ESPAÑOLA DE NUEVOS TRATAMIENTOS\";s:3:\"nbr\";s:1:\"6\";}i:117;a:2:{s:4:\"name\";s:6:\"MISSHA\";s:3:\"nbr\";s:1:\"5\";}i:119;a:2:{s:4:\"name\";s:6:\"TIRTIR\";s:3:\"nbr\";s:1:\"6\";}i:120;a:2:{s:4:\"name\";s:10:\"Dr. Althea\";s:3:\"nbr\";s:1:\"1\";}i:121;a:2:{s:4:\"name\";s:13:\"UNICSKIN S.L.\";s:3:\"nbr\";s:1:\"2\";}i:122;a:2:{s:4:\"name\";s:19:\"ALTA COMESTICA S.L.\";s:3:\"nbr\";s:1:\"1\";}i:123;a:2:{s:4:\"name\";s:4:\"FIMO\";s:3:\"nbr\";s:1:\"1\";}i:124;a:2:{s:4:\"name\";s:42:\"ASOCIACION ESPAÑOLA DE PKAN ISBEL HEREDIA\";s:3:\"nbr\";s:1:\"1\";}i:125;a:2:{s:4:\"name\";s:4:\"ANUA\";s:3:\"nbr\";s:1:\"4\";}i:126;a:3:{s:4:\"name\";s:12:\"VT COSMETICS\";s:3:\"nbr\";s:1:\"3\";s:7:\"checked\";b:1;}i:127;a:2:{s:4:\"name\";s:12:\"BIOCOSMETICS\";s:3:\"nbr\";s:1:\"1\";}i:128;a:2:{s:4:\"name\";s:8:\"ASIN FCA\";s:3:\"nbr\";s:1:\"2\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:2;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:38;s:3:\"min\";d:4;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:31;s:5:\"value\";N;}i:3;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Selecciones\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:9:\"En oferta\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:5:\"Nuevo\";s:3:\"nbr\";i:2;}s:8:\"discount\";a:2:{s:4:\"name\";s:13:\"Con descuento\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
1.841 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:210
671
INSERT INTO `och438connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('199196', '', 'farmacialanueva.online/22-facial?q=Marca-BIODES-MEDICUBE-VT+COSMETICS&resultsPerPage=36', '', '2026-06-22 20:01:34')
1.610 ms 1 /classes/ObjectModel.php:622
108
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `och438hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `och438hook_alias` ha
INNER JOIN `och438hook` h ON ha.name = h.name
1.550 ms 0 /classes/Hook.php:1348
72
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
1.506 ms 248 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `och438module` m
INNER JOIN och438module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `och438hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `och438hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `och438module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.426 ms 1560 Yes Yes /classes/Hook.php:1289
91
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 6) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-06-22 20:01:34' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-06-22 20:01:34' <= sp.to) 
) WHERE ((sp.reduction>0))
1.422 ms 124 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
75
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.level_depth<=3 AND c.nleft>7 AND c.nright<40 GROUP BY cp.id_category
1.388 ms 248 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
109
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `och438hook_module` hm
STRAIGHT_JOIN `och438hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `och438module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
1.387 ms 524 /classes/Hook.php:455
93
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-06-22 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM och438product p
LEFT JOIN och438product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN och438stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN och438product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (2455,2425,2431,2456,2522,2665,2662,2432,2453,2430,2510,2521,1889,1888,1890,2305,2312,2314,2460,2467,2496,2518,2538,2539,2540,2542,2553,2555,2639,2638,2641)
1.268 ms 31 /classes/ProductAssembler.php:95
90
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE p.date_add>'2026-06-03 00:00:00'
1.217 ms 124 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `och438meta` m
LEFT JOIN `och438meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
1.185 ms 57 Yes /classes/Dispatcher.php:654
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `och438lang` l
JOIN och438lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
1.149 ms 1 /classes/Language.php:1214
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `och438hook`
1.122 ms 1143 /classes/Hook.php:1348
673
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `och438category_product` cp
LEFT JOIN `och438category` c ON (c.id_category = cp.id_category)
LEFT JOIN `och438category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (2455,2425,2431,2456,2522,2665,2662,2432,2453,2430,2510,2521,1889,1888,1890,2305,2312,2314,2460,2467,2496,2518,2538,2539,2540,2542,2553,2555,2639,2638,2641) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
1.110 ms 2745 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:103
89
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p WHERE ((p.on_sale=1))
1.089 ms 124 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `och438hook` h
WHERE (h.active = 1)
1.038 ms 1143 /classes/Hook.php:1388
84
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM och438product p INNER JOIN och438layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 6) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40
0.912 ms 62 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
69
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.852 ms 129 Yes /classes/Manufacturer.php:201
37
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `och438category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 22
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.838 ms 61 Yes Yes /classes/Category.php:916
217
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2430) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.835 ms 1 /classes/stock/StockAvailable.php:453
82
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `och438manufacturer` m INNER JOIN och438manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `och438manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.809 ms 129 Yes /classes/Manufacturer.php:201
340
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2518 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2518 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.744 ms 0 /classes/Cart.php:1430
79
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=2)) GROUP BY pac.id_attribute
0.741 ms 124 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
86
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=3)) GROUP BY pac.id_attribute
0.723 ms 124 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
270
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1890 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.720 ms 1 Yes /classes/SpecificPrice.php:576
656
SELECT SQL_NO_CACHE c.*, cl.*
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `och438category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `och438category` c2 ON c2.`id_category` = 22 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 6 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
0.666 ms 61 Yes Yes /classes/Category.php:785
433
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2641 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2641 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.659 ms 0 /classes/Cart.php:1430
76
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 1 ORDER BY agl.`name` ASC, a.`position` ASC
0.644 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
68
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `och438feature` f  INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `och438feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `och438layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.637 ms 6 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:159
77
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=1)) GROUP BY pac.id_attribute
0.633 ms 124 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.598 ms 104 /classes/module/Module.php:341
88
SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN och438attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=4)) GROUP BY pac.id_attribute
0.595 ms 124 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2432 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.590 ms 1 Yes /classes/SpecificPrice.php:576
74
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `och438category` c
INNER JOIN och438category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `och438category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.585 ms 61 Yes /classes/Category.php:710
488
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2314) AND (b.`id_shop` = 1) LIMIT 1
0.576 ms 1 /src/Adapter/EntityMapper.php:71
248
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1889 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.575 ms 1 Yes /classes/SpecificPrice.php:576
206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2453 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2453 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.564 ms 0 /classes/Cart.php:1430
80
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=1)) GROUP BY fp.id_feature_value
0.562 ms 124 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
506
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2539) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
201
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2453 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.549 ms 1 Yes /classes/SpecificPrice.php:576
259
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1888 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.546 ms 1 Yes /classes/SpecificPrice.php:576
81
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM och438product p LEFT JOIN och438product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN och438product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN och438stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN och438product_sale psales ON (psales.id_product = p.id_product) INNER JOIN och438category_product cp ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN och438category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN och438category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (99, 115, 126) AND c.nleft>=7 AND c.nright<=40 GROUP BY p.id_product) p INNER JOIN och438feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=2)) GROUP BY fp.id_feature_value
0.542 ms 124 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
67
SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `och438attribute_group` ag  INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `och438layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `och438layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC
0.536 ms 4 Yes Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122
101
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `och438specific_price` WHERE `id_product` != 0
0.536 ms 521 /classes/SpecificPrice.php:310
64
SELECT SQL_NO_CACHE `name`
FROM `och438hook`
WHERE `id_hook` = 746 LIMIT 1
0.530 ms 1 /classes/Hook.php:244
85
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 3 ORDER BY agl.`name` ASC, a.`position` ASC
0.529 ms 3 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
502
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2518
0.527 ms 1 /classes/Product.php:2899
54
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.524 ms 0 /classes/module/Module.php:2664
87
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 4 ORDER BY agl.`name` ASC, a.`position` ASC
0.524 ms 4 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
346
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2538 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.512 ms 1 Yes /classes/SpecificPrice.php:576
473
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1889) AND (b.`id_shop` = 1) LIMIT 1
0.512 ms 1 /src/Adapter/EntityMapper.php:71
419
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2638 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.511 ms 1 Yes /classes/SpecificPrice.php:576
357
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2539 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.509 ms 1 Yes /classes/SpecificPrice.php:576
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2432 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2432 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.508 ms 0 /classes/Cart.php:1430
557
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitreviews" LIMIT 1
0.504 ms 1 /classes/module/Module.php:2664
479
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1890) AND (b.`id_shop` = 1) LIMIT 1
0.501 ms 1 /src/Adapter/EntityMapper.php:71
159
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2522 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.500 ms 1 Yes /classes/SpecificPrice.php:576
117
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2455 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2455 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.499 ms 0 /classes/Cart.php:1430
408
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2639 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.498 ms 1 Yes /classes/SpecificPrice.php:576
124
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2425 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.491 ms 1 Yes /classes/SpecificPrice.php:576
583
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2453 LIMIT 1
0.491 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
78
SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `och438attribute_group` ag INNER JOIN `och438attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `och438attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN och438attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1)  INNER JOIN och438attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `och438layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 2 ORDER BY agl.`name` ASC, a.`position` ASC
0.485 ms 14 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77
563
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2425) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.485 ms 1 Yes Yes /classes/Product.php:4513
560
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2455) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.481 ms 1 Yes Yes /classes/Product.php:4513
587
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2430) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.480 ms 1 Yes Yes /classes/Product.php:4513
512
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2542) AND (b.`id_shop` = 1) LIMIT 1
0.479 ms 1 /src/Adapter/EntityMapper.php:71
17
SELECT SQL_NO_CACHE value FROM `och438configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.478 ms 1 /classes/shop/Shop.php:1183
353
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2539
AND image_shop.`cover` = 1 LIMIT 1
0.478 ms 1 /classes/Product.php:3570
446
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2456) AND (b.`id_shop` = 1) LIMIT 1
0.478 ms 1 /src/Adapter/EntityMapper.php:71
105
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2455 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.478 ms 1 Yes /classes/SpecificPrice.php:576
147
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2456 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.477 ms 1 Yes /classes/SpecificPrice.php:576
518
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2555) AND (b.`id_shop` = 1) LIMIT 1
0.477 ms 1 /src/Adapter/EntityMapper.php:71
379
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.476 ms 1 Yes /classes/SpecificPrice.php:576
590
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2510) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.476 ms 1 Yes Yes /classes/Product.php:4513
22
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `och438module` m
LEFT JOIN `och438module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.470 ms 104 /classes/module/Module.php:341
509
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2540) AND (b.`id_shop` = 1) LIMIT 1
0.470 ms 1 /src/Adapter/EntityMapper.php:71
241
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.469 ms 0 /classes/Cart.php:1430
135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2431 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.468 ms 1 Yes /classes/SpecificPrice.php:576
494
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2467) AND (b.`id_shop` = 1) LIMIT 1
0.468 ms 1 /src/Adapter/EntityMapper.php:71
578
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2662) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.468 ms 1 Yes Yes /classes/Product.php:4513
443
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2431) AND (b.`id_shop` = 1) LIMIT 1
0.466 ms 1 /src/Adapter/EntityMapper.php:71
165
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2522
ORDER BY f.position ASC
0.466 ms 1 Yes /classes/Product.php:6024
362
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2539 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2539 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.464 ms 0 /classes/Cart.php:1430
605
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2305) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.464 ms 1 Yes Yes /classes/Product.php:4513
236
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.463 ms 1 Yes /classes/SpecificPrice.php:576
368
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2540 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.463 ms 1 Yes /classes/SpecificPrice.php:576
566
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2431) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.461 ms 1 Yes Yes /classes/Product.php:4513
559
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2455 LIMIT 1
0.460 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
575
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2665) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4513
635
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4513
341
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2518
ORDER BY f.position ASC
0.457 ms 1 Yes /classes/Product.php:6024
524
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2638) AND (b.`id_shop` = 1) LIMIT 1
0.457 ms 1 /src/Adapter/EntityMapper.php:71
531
SELECT SQL_NO_CACHE 1 FROM och438cart_product cp INNER JOIN och438product p
ON (p.id_product = cp.id_product) INNER JOIN och438product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.457 ms 1 /classes/Cart.php:4250
226
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2510)
0.456 ms 1 /classes/Product.php:3860
152
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2456 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2456 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.455 ms 0 /classes/Cart.php:1430
225
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2510 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.454 ms 1 Yes /classes/SpecificPrice.php:576
265
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1888
ORDER BY f.position ASC
0.452 ms 1 Yes /classes/Product.php:6024
100
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `id_product` != 0 LIMIT 1
0.451 ms 521 /classes/SpecificPrice.php:297
449
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2522) AND (b.`id_shop` = 1) LIMIT 1
0.451 ms 1 /src/Adapter/EntityMapper.php:71
384
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.451 ms 0 /classes/Cart.php:1430
483
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2305
ORDER BY `position`
0.450 ms 1 Yes /classes/Product.php:3539
515
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2553) AND (b.`id_shop` = 1) LIMIT 1
0.450 ms 1 /src/Adapter/EntityMapper.php:71
66
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM och438layered_category
WHERE controller = 'category'
AND id_category = 22
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.446 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
213
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2430 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.442 ms 1 Yes /classes/SpecificPrice.php:576
521
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2639) AND (b.`id_shop` = 1) LIMIT 1
0.441 ms 1 /src/Adapter/EntityMapper.php:71
275
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1890 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1890 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.440 ms 0 /classes/Cart.php:1430
373
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2540 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2540 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.440 ms 0 /classes/Cart.php:1430
129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2425 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2425 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.439 ms 0 /classes/Cart.php:1430
332
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2496
ORDER BY f.position ASC
0.438 ms 1 Yes /classes/Product.php:6024
327
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2496)
0.436 ms 1 /classes/Product.php:3860
461
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2453) AND (b.`id_shop` = 1) LIMIT 1
0.435 ms 1 /src/Adapter/EntityMapper.php:71
491
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2460) AND (b.`id_shop` = 1) LIMIT 1
0.435 ms 1 /src/Adapter/EntityMapper.php:71
532
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.434 ms 13 /classes/CartRule.php:357
313
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2460 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2460 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.434 ms 0 /classes/Cart.php:1430
626
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2538) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.433 ms 1 Yes Yes /classes/Product.php:4513
253
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1889 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1889 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.432 ms 0 /classes/Cart.php:1430
638
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2553) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.432 ms 1 Yes Yes /classes/Product.php:4513
602
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1890) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.431 ms 1 Yes Yes /classes/Product.php:4513
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM och438shop_group gs
LEFT JOIN och438shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN och438shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.429 ms 1 Yes /classes/shop/Shop.php:715
613
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2460 LIMIT 1
0.429 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
455
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2662) AND (b.`id_shop` = 1) LIMIT 1
0.428 ms 1 /src/Adapter/EntityMapper.php:71
402
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2555 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2555 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.427 ms 0 /classes/Cart.php:1430
470
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2521) AND (b.`id_shop` = 1) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
183
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2662 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2662 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.425 ms 0 /classes/Cart.php:1430
620
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2496) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.424 ms 1 Yes Yes /classes/Product.php:4513
440
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2425) AND (b.`id_shop` = 1) LIMIT 1
0.423 ms 1 /src/Adapter/EntityMapper.php:71
19
SELECT SQL_NO_CACHE name, alias FROM `och438hook_alias`
0.422 ms 88 /classes/Hook.php:342
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2431 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2431 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.422 ms 0 /classes/Cart.php:1430
424
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2638 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2638 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.422 ms 0 /classes/Cart.php:1430
242
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2521
ORDER BY f.position ASC
0.421 ms 1 Yes /classes/Product.php:6024
632
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2540) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.421 ms 1 Yes Yes /classes/Product.php:4513
584
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2453) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.420 ms 1 Yes Yes /classes/Product.php:4513
641
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2555) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.420 ms 1 Yes Yes /classes/Product.php:4513
237
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2521)
0.419 ms 1 /classes/Product.php:3860
450
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2522
ORDER BY `position`
0.418 ms 1 Yes /classes/Product.php:3539
593
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.418 ms 1 Yes Yes /classes/Product.php:4513
43
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 42) AND (b.`id_shop` = 1) LIMIT 1
0.417 ms 1 /src/Adapter/EntityMapper.php:71
385
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2542
ORDER BY f.position ASC
0.417 ms 1 Yes /classes/Product.php:6024
281
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `och438specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2305 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-06-22 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.416 ms 1 Yes /classes/SpecificPrice.php:576
527
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2641) AND (b.`id_shop` = 1) LIMIT 1
0.416 ms 1 /src/Adapter/EntityMapper.php:71
647
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2638) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.416 ms 1 Yes Yes /classes/Product.php:4513
628
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2539 LIMIT 1
0.416 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
458
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2432) AND (b.`id_shop` = 1) LIMIT 1
0.415 ms 1 /src/Adapter/EntityMapper.php:71
264
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1888 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1888 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.414 ms 0 /classes/Cart.php:1430
500
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2518) AND (b.`id_shop` = 1) LIMIT 1
0.414 ms 1 /src/Adapter/EntityMapper.php:71
507
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2539
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3539
114
SELECT SQL_NO_CACHE `reduction`
FROM `och438group`
WHERE `id_group` = 1 LIMIT 1
0.413 ms 1 /classes/Group.php:151
164
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2522 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2522 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.413 ms 0 /classes/Cart.php:1430
207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2453
ORDER BY f.position ASC
0.413 ms 1 Yes /classes/Product.php:6024
218
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2430 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2430 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.413 ms 0 /classes/Cart.php:1430
435
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2455) AND (b.`id_shop` = 1) LIMIT 1
0.413 ms 1 /src/Adapter/EntityMapper.php:71
485
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2312) AND (b.`id_shop` = 1) LIMIT 1
0.412 ms 1 /src/Adapter/EntityMapper.php:71
476
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1888) AND (b.`id_shop` = 1) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
629
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2539) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.409 ms 1 Yes Yes /classes/Product.php:4513
331
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2496 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2496 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.408 ms 0 /classes/Cart.php:1430
393
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2553 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2553 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.408 ms 0 /classes/Cart.php:1430
464
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2430) AND (b.`id_shop` = 1) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
60
SELECT SQL_NO_CACHE *
FROM `och438country_lang`
WHERE `id_country` = 6
0.405 ms 1 /src/Adapter/EntityMapper.php:79
173
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2665 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2665 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.405 ms 0 /classes/Cart.php:1430
413
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2639 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2639 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.405 ms 0 /classes/Cart.php:1430
608
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2312) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.405 ms 1 Yes Yes /classes/Product.php:4513
510
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2540
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3539
649
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2641 LIMIT 1
0.404 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
286
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2305 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.404 ms 0 /classes/Cart.php:1430
230
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2510 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2510 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.403 ms 0 /classes/Cart.php:1430
304
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2314 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2314 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.403 ms 0 /classes/Cart.php:1430
581
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2432) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.403 ms 1 Yes Yes /classes/Product.php:4513
630
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2540
0.403 ms 2 /classes/Product.php:3420
297
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2314
AND image_shop.`cover` = 1 LIMIT 1
0.403 ms 3 /classes/Product.php:3570
351
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2538 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2538 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.400 ms 0 /classes/Cart.php:1430
529
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2641
0.400 ms 1 /classes/Product.php:2899
148
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2456)
0.400 ms 1 /classes/Product.php:3860
596
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1889) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.400 ms 1 Yes Yes /classes/Product.php:4513
398
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2555)
0.398 ms 1 /classes/Product.php:3860
452
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2665) AND (b.`id_shop` = 1) LIMIT 1
0.398 ms 1 /src/Adapter/EntityMapper.php:71
482
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2305) AND (b.`id_shop` = 1) LIMIT 1
0.398 ms 1 /src/Adapter/EntityMapper.php:71
611
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2314) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.397 ms 1 Yes Yes /classes/Product.php:4513
23
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) AND (b.`id_shop` = 1) LIMIT 1
0.395 ms 1 /src/Adapter/EntityMapper.php:71
322
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2467 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2467 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.395 ms 0 /classes/Cart.php:1430
650
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2641) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.395 ms 1 Yes Yes /classes/Product.php:4513
672
SELECT SQL_NO_CACHE data
FROM `och438ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.394 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:39
497
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2496) AND (b.`id_shop` = 1) LIMIT 1
0.394 ms 1 /src/Adapter/EntityMapper.php:71
102
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `from` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.393 ms 1 /classes/SpecificPrice.php:377
623
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2518) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.391 ms 1 Yes Yes /classes/Product.php:4513
62
SELECT SQL_NO_CACHE *
FROM `och438category` a0
LEFT JOIN `och438category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 7) AND (a0.`nright` > 40) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.391 ms 4 /classes/PrestaShopCollection.php:383
35
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.390 ms 1 /classes/Category.php:2446
154
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2522
AND image_shop.`cover` = 1 LIMIT 1
0.390 ms 1 /classes/Product.php:3570
599
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1888) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.390 ms 1 Yes Yes /classes/Product.php:4513
295
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `och438cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2312 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `och438cart_product` cp JOIN `och438pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `och438product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2312 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.389 ms 0 /classes/Cart.php:1430
352
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2538
ORDER BY f.position ASC
0.389 ms 1 Yes /classes/Product.php:6024
569
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2456) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.388 ms 1 Yes Yes /classes/Product.php:4513
303
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2314) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.388 ms 1 /classes/stock/StockAvailable.php:453
24
SELECT SQL_NO_CACHE * FROM `och438currency` c ORDER BY `iso_code` ASC
0.387 ms 1 Yes /classes/Currency.php:708
110
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.387 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:100
467
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2510) AND (b.`id_shop` = 1) LIMIT 1
0.387 ms 1 /src/Adapter/EntityMapper.php:71
617
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2467) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.386 ms 1 Yes Yes /classes/Product.php:4513
644
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2639) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.386 ms 1 Yes Yes /classes/Product.php:4513
409
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2639)
0.385 ms 1 /classes/Product.php:3860
503
SELECT SQL_NO_CACHE *
FROM `och438product` a
LEFT JOIN `och438product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `och438product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2538) AND (b.`id_shop` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
572
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2522) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.384 ms 1 Yes Yes /classes/Product.php:4513
296
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2312
ORDER BY f.position ASC
0.384 ms 1 Yes /classes/Product.php:6024
219
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2430
ORDER BY f.position ASC
0.383 ms 1 Yes /classes/Product.php:6024
614
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `och438product_attribute` pa
INNER JOIN och438product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `och438product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `och438attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `och438attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `och438attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2460) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.383 ms 1 Yes Yes /classes/Product.php:4513
468
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2510
ORDER BY `position`
0.383 ms 1 Yes /classes/Product.php:3539
118
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2455
ORDER BY f.position ASC
0.382 ms 1 Yes /classes/Product.php:6024
370
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2540 AND id_shop=1 LIMIT 1
0.382 ms 1 /classes/Product.php:6884
291
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2312)
0.382 ms 1 /classes/Product.php:3860
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `och438lang` l
LEFT JOIN `och438lang_shop` ls ON (l.id_lang = ls.id_lang)
0.380 ms 1 /classes/Language.php:1080
48
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1
0.380 ms 1 /src/Adapter/EntityMapper.php:71
119
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2425
AND image_shop.`cover` = 1 LIMIT 1
0.380 ms 1 /classes/Product.php:3570
363
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2539
ORDER BY f.position ASC
0.380 ms 1 Yes /classes/Product.php:6024
99
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2455 LIMIT 1
0.379 ms 1 /classes/SpecificPrice.php:435
364
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2540
AND image_shop.`cover` = 1 LIMIT 1
0.379 ms 1 /classes/Product.php:3570
365
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.378 ms 1 /classes/Product.php:5670
249
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1889)
0.378 ms 1 /classes/Product.php:3860
32
SELECT SQL_NO_CACHE *
FROM `och438group` a
LEFT JOIN `och438group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.377 ms 1 /src/Adapter/EntityMapper.php:71
533
SELECT SQL_NO_CACHE 1 FROM `och438cart_rule` WHERE ((date_to >= "2026-06-22 00:00:00" AND date_to <= "2026-06-22 23:59:59") OR (date_from >= "2026-06-22 00:00:00" AND date_from <= "2026-06-22 23:59:59") OR (date_from < "2026-06-22 00:00:00" AND date_to > "2026-06-22 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.377 ms 13 /classes/CartRule.php:357
670
SELECT SQL_NO_CACHE `id_guest`
FROM `och438connections`
WHERE `id_guest` = 199631
AND `date_add` > '2026-06-22 19:31:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.376 ms 1 Yes /classes/Connection.php:168
115
SELECT SQL_NO_CACHE tr.*
FROM `och438tax_rule` tr
JOIN `och438tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.375 ms 0 /classes/tax/TaxRulesTaxManager.php:100
260
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1888)
0.374 ms 1 /classes/Product.php:3860
71
SELECT SQL_NO_CACHE *
FROM `och438category_lang`
WHERE `id_category` = 22 AND `id_shop` = 1
0.373 ms 1 /src/Adapter/EntityMapper.php:79
153
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2456
ORDER BY f.position ASC
0.373 ms 1 Yes /classes/Product.php:6024
622
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2518 LIMIT 1
0.373 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
27
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.372 ms 1 /src/Adapter/EntityMapper.php:71
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM och438shop_url su
LEFT JOIN och438shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'farmacialanueva.online' OR su.domain_ssl = 'farmacialanueva.online')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.371 ms 1 Yes /classes/shop/Shop.php:1364
475
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1889
0.371 ms 1 /classes/Product.php:2899
610
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2314 LIMIT 1
0.371 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
658
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.371 ms 1 /src/Adapter/EntityMapper.php:71
386
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2553
AND image_shop.`cover` = 1 LIMIT 1
0.370 ms 3 /classes/Product.php:3570
112
SELECT SQL_NO_CACHE *
FROM `och438tax_lang`
WHERE `id_tax` = 31
0.370 ms 1 /src/Adapter/EntityMapper.php:79
9
SELECT SQL_NO_CACHE *
FROM `och438lang` a
LEFT JOIN `och438lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.369 ms 1 /src/Adapter/EntityMapper.php:71
528
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2641
ORDER BY `position`
0.369 ms 4 Yes /classes/Product.php:3539
231
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2510
ORDER BY f.position ASC
0.369 ms 1 Yes /classes/Product.php:6024
425
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2638
ORDER BY f.position ASC
0.368 ms 1 Yes /classes/Product.php:6024
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM och438shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.367 ms 1 /classes/shop/ShopUrl.php:178
486
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2312
ORDER BY `position`
0.367 ms 4 Yes /classes/Product.php:3539
513
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2542
ORDER BY `position`
0.367 ms 2 Yes /classes/Product.php:3539
31
SELECT SQL_NO_CACHE id_shop
FROM `och438currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.366 ms 1 /classes/ObjectModel.php:1727
243
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1889
AND image_shop.`cover` = 1 LIMIT 1
0.366 ms 1 /classes/Product.php:3570
21
SELECT SQL_NO_CACHE * FROM `och438hook_module_exceptions`
WHERE `id_shop` IN (1)
0.365 ms 1 /classes/module/Module.php:2046
94
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2455
AND image_shop.`cover` = 1 LIMIT 1
0.365 ms 1 /classes/Product.php:3570
40
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 33) AND (b.`id_shop` = 1) LIMIT 1
0.364 ms 1 /src/Adapter/EntityMapper.php:71
107
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2455 AND id_shop=1 LIMIT 1
0.364 ms 1 /classes/Product.php:6884
378
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.364 ms 1 /classes/SpecificPrice.php:256
374
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2540
ORDER BY f.position ASC
0.363 ms 1 Yes /classes/Product.php:6024
160
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2522)
0.360 ms 1 /classes/Product.php:3860
477
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1888
ORDER BY `position`
0.360 ms 2 Yes /classes/Product.php:3539
436
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2455
ORDER BY `position`
0.360 ms 1 Yes /classes/Product.php:3539
130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2425
ORDER BY f.position ASC
0.359 ms 1 Yes /classes/Product.php:6024
298
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.359 ms 1 /classes/Product.php:5670
462
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2453
ORDER BY `position`
0.359 ms 1 Yes /classes/Product.php:3539
516
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2553
ORDER BY `position`
0.359 ms 3 Yes /classes/Product.php:3539
525
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2638
ORDER BY `position`
0.358 ms 2 Yes /classes/Product.php:3539
342
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2538
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 1 /classes/Product.php:3570
573
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2665
0.357 ms 3 /classes/Product.php:3420
646
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2638 LIMIT 1
0.357 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM och438shop s
LEFT JOIN och438shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.356 ms 1 /classes/shop/Shop.php:214
7
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.356 ms 1 /src/Adapter/EntityMapper.php:71
394
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2553
ORDER BY f.position ASC
0.356 ms 1 Yes /classes/Product.php:6024
489
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2314
ORDER BY `position`
0.356 ms 3 Yes /classes/Product.php:3539
56
SELECT SQL_NO_CACHE * FROM `och438image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.355 ms 8 Yes /classes/ImageType.php:109
268
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1890 LIMIT 1
0.355 ms 1 /classes/SpecificPrice.php:435
487
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2312
0.355 ms 1 /classes/Product.php:2899
29
SELECT SQL_NO_CACHE *
FROM `och438currency` a
LEFT JOIN `och438currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2432
ORDER BY f.position ASC
0.354 ms 1 Yes /classes/Product.php:6024
360
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2539 AND `id_group` = 1 LIMIT 1
0.354 ms 0 /classes/GroupReduction.php:153
636
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2553
0.354 ms 4 /classes/Product.php:3420
45
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 44) AND (b.`id_shop` = 1) LIMIT 1
0.353 ms 1 /src/Adapter/EntityMapper.php:71
215
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2430 AND id_shop=1 LIMIT 1
0.353 ms 1 /classes/Product.php:6884
321
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2467) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.353 ms 1 /classes/stock/StockAvailable.php:453
619
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2496 LIMIT 1
0.352 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
41
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 40) AND (b.`id_shop` = 1) LIMIT 1
0.352 ms 1 /src/Adapter/EntityMapper.php:71
499
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2496
0.352 ms 1 /classes/Product.php:2899
36
SELECT SQL_NO_CACHE ctg.`id_group`
FROM och438category_group ctg
WHERE ctg.`id_category` = 22 AND ctg.`id_group` = 1 LIMIT 1
0.351 ms 1 /classes/Category.php:1751
498
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2496
ORDER BY `position`
0.351 ms 2 Yes /classes/Product.php:3539
38
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 26) AND (b.`id_shop` = 1) LIMIT 1
0.350 ms 1 /src/Adapter/EntityMapper.php:71
355
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2539 LIMIT 1
0.350 ms 1 /classes/SpecificPrice.php:435
595
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1889 LIMIT 1
0.349 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
522
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2639
ORDER BY `position`
0.348 ms 1 Yes /classes/Product.php:3539
254
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1889
ORDER BY f.position ASC
0.347 ms 1 Yes /classes/Product.php:6024
287
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2305
ORDER BY f.position ASC
0.347 ms 1 Yes /classes/Product.php:6024
44
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 43) AND (b.`id_shop` = 1) LIMIT 1
0.347 ms 1 /src/Adapter/EntityMapper.php:71
405
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.347 ms 1 /classes/Product.php:5670
492
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2460
ORDER BY `position`
0.347 ms 3 Yes /classes/Product.php:3539
403
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2555
ORDER BY f.position ASC
0.346 ms 1 Yes /classes/Product.php:6024
106
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2455)
0.346 ms 1 /classes/Product.php:3860
504
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2538
ORDER BY `position`
0.346 ms 1 Yes /classes/Product.php:3539
585
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2430
0.346 ms 2 /classes/Product.php:3420
634
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2542 LIMIT 1
0.346 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
662
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.346 ms 1 /classes/module/Module.php:2664
637
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2553 LIMIT 1
0.345 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2431
ORDER BY f.position ASC
0.345 ms 1 Yes /classes/Product.php:6024
174
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2665
ORDER BY f.position ASC
0.345 ms 1 Yes /classes/Product.php:6024
474
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1889
ORDER BY `position`
0.345 ms 1 Yes /classes/Product.php:3539
536
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `och438currency` c
LEFT JOIN och438currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.345 ms 1 /classes/Currency.php:1134
39
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 29) AND (b.`id_shop` = 1) LIMIT 1
0.344 ms 1 /src/Adapter/EntityMapper.php:71
42
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 41) AND (b.`id_shop` = 1) LIMIT 1
0.344 ms 1 /src/Adapter/EntityMapper.php:71
116
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2455) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:453
271
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1890)
0.344 ms 1 /classes/Product.php:3860
603
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2305
0.344 ms 3 /classes/Product.php:3420
208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2430
AND image_shop.`cover` = 1 LIMIT 1
0.343 ms 1 /classes/Product.php:3570
471
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2521
ORDER BY `position`
0.342 ms 1 Yes /classes/Product.php:3539
653
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c LEFT JOIN och438iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 22 AND s.id_shop = 1 LIMIT 1
0.342 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2432) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.342 ms 1 /classes/stock/StockAvailable.php:453
420
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2638)
0.342 ms 1 /classes/Product.php:3860
547
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `och438cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.342 ms 1 /classes/Cart.php:1300
607
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2312 LIMIT 1
0.342 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
30
SELECT SQL_NO_CACHE *
FROM `och438currency_lang`
WHERE `id_currency` = 1
0.341 ms 1 /src/Adapter/EntityMapper.php:79
113
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2455 AND `id_group` = 1 LIMIT 1
0.341 ms 0 /classes/GroupReduction.php:153
211
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2430 LIMIT 1
0.341 ms 1 /classes/SpecificPrice.php:435
480
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1890
ORDER BY `position`
0.341 ms 1 Yes /classes/Product.php:3539
495
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2467
ORDER BY `position`
0.341 ms 1 Yes /classes/Product.php:3539
554
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.341 ms 1 /classes/module/Module.php:2664
631
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2540 LIMIT 1
0.341 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
404
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2639
AND image_shop.`cover` = 1 LIMIT 1
0.340 ms 1 /classes/Product.php:3570
375
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2542
AND image_shop.`cover` = 1 LIMIT 1
0.340 ms 2 /classes/Product.php:3570
519
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2555
ORDER BY `position`
0.340 ms 1 Yes /classes/Product.php:3539
8
SELECT SQL_NO_CACHE *
FROM `och438shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.338 ms 1 /src/Adapter/EntityMapper.php:71
131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2431
AND image_shop.`cover` = 1 LIMIT 1
0.338 ms 1 /classes/Product.php:3570
661
SELECT SQL_NO_CACHE c.*, cl.*  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 121 ORDER BY `nleft` DESC
0.338 ms 4 /classes/Category.php:1594
414
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2639
ORDER BY f.position ASC
0.337 ms 1 Yes /classes/Product.php:6024
555
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 64 AND `id_shop` = 1 LIMIT 1
0.337 ms 1 /classes/module/Module.php:2137
456
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2662
ORDER BY `position`
0.336 ms 1 Yes /classes/Product.php:3539
586
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2430 LIMIT 1
0.336 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
592
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2521 LIMIT 1
0.336 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
571
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2522 LIMIT 1
0.335 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
664
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.335 ms 1 /classes/module/Module.php:2664
565
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2431 LIMIT 1
0.335 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
220
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2510
AND image_shop.`cover` = 1 LIMIT 1
0.334 ms 1 /classes/Product.php:3570
459
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2432
ORDER BY `position`
0.334 ms 1 Yes /classes/Product.php:3539
465
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2430
ORDER BY `position`
0.334 ms 1 Yes /classes/Product.php:3539
643
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2639 LIMIT 1
0.334 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
314
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2460
ORDER BY f.position ASC
0.334 ms 1 Yes /classes/Product.php:6024
328
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2496 AND id_shop=1 LIMIT 1
0.333 ms 1 /classes/Product.php:6884
434
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2641
ORDER BY f.position ASC
0.333 ms 1 Yes /classes/Product.php:6024
580
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2432 LIMIT 1
0.332 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
266
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1890
AND image_shop.`cover` = 1 LIMIT 1
0.332 ms 1 /classes/Product.php:3570
444
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2431
ORDER BY `position`
0.332 ms 1 Yes /classes/Product.php:3539
33
SELECT SQL_NO_CACHE *
FROM `och438group_lang`
WHERE `id_group` = 1
0.331 ms 1 /src/Adapter/EntityMapper.php:79
526
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2638
0.331 ms 1 /classes/Product.php:2899
604
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2305 LIMIT 1
0.331 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
616
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2467 LIMIT 1
0.331 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
627
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2539
0.330 ms 2 /classes/Product.php:3420
25
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.330 ms 1 /classes/Language.php:880
47
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 94) AND (b.`id_shop` = 1) LIMIT 1
0.329 ms 1 /src/Adapter/EntityMapper.php:71
184
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2662
ORDER BY f.position ASC
0.329 ms 1 Yes /classes/Product.php:6024
232
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2521
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 1 /classes/Product.php:3570
415
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2638
AND image_shop.`cover` = 1 LIMIT 1
0.329 ms 2 /classes/Product.php:3570
561
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2425
0.329 ms 2 /classes/Product.php:3420
589
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2510 LIMIT 1
0.329 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
58
SELECT SQL_NO_CACHE `need_identification_number`
FROM `och438country`
WHERE `id_country` = 6 LIMIT 1
0.328 ms 1 /classes/Country.php:402
70
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 22) LIMIT 1
0.328 ms 1 /src/Adapter/EntityMapper.php:71
556
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2455
0.328 ms 2 /classes/Product.php:3420
34
SELECT SQL_NO_CACHE id_shop
FROM `och438group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.328 ms 1 /classes/ObjectModel.php:1727
179
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2662)
0.327 ms 1 /classes/Product.php:3860
276
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1890
ORDER BY f.position ASC
0.327 ms 1 Yes /classes/Product.php:6024
601
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1890 LIMIT 1
0.327 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
305
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2314
ORDER BY f.position ASC
0.327 ms 1 Yes /classes/Product.php:6024
447
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2456
ORDER BY `position`
0.326 ms 1 Yes /classes/Product.php:3539
441
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2425
ORDER BY `position`
0.326 ms 1 Yes /classes/Product.php:3539
625
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2538 LIMIT 1
0.326 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
0
SELECT SQL_NO_CACHE * FROM och438memcached_servers
0.325 ms 1 /classes/cache/CacheMemcached.php:263
28
SELECT SQL_NO_CACHE `id_lang` FROM `och438lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.325 ms 1 /classes/Language.php:880
369
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2540)
0.325 ms 1 /classes/Product.php:3860
98
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 0 LIMIT 1
0.324 ms 1 /classes/SpecificPrice.php:426
453
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2665
ORDER BY `position`
0.324 ms 1 Yes /classes/Product.php:3539
26
SELECT SQL_NO_CACHE c.id_currency
FROM `och438currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.323 ms 1 /classes/Currency.php:893
591
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2521
0.323 ms 2 /classes/Product.php:3420
517
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2553
0.323 ms 1 /classes/Product.php:2899
10
SELECT SQL_NO_CACHE id_shop
FROM `och438lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.322 ms 1 /classes/ObjectModel.php:1727
380
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2542)
0.322 ms 1 /classes/Product.php:3860
426
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2641
AND image_shop.`cover` = 1 LIMIT 1
0.322 ms 4 /classes/Product.php:3570
568
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2456 LIMIT 1
0.322 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
588
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2510
0.322 ms 2 /classes/Product.php:3420
247
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1889
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.321 ms 0 /classes/SpecificPrice.php:256
358
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2539)
0.321 ms 1 /classes/Product.php:3860
381
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2542 AND id_shop=1 LIMIT 1
0.321 ms 1 /classes/Product.php:6884
501
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `och438image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2518
ORDER BY `position`
0.321 ms 1 Yes /classes/Product.php:3539
648
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2641
0.321 ms 5 /classes/Product.php:3420
126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2425 AND id_shop=1 LIMIT 1
0.320 ms 1 /classes/Product.php:6884
323
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM och438feature_product pf
LEFT JOIN och438feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN och438feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN och438feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN och438feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2467
ORDER BY f.position ASC
0.320 ms 1 Yes /classes/Product.php:6024
63
SELECT SQL_NO_CACHE * FROM och438revslider_sliders
0.320 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2425)
0.320 ms 1 /classes/Product.php:3860
657
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `och438category` c
LEFT JOIN `och438category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.320 ms 1 /classes/Category.php:2239
4
SELECT SQL_NO_CACHE *
FROM `och438shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
255
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1888
AND image_shop.`cover` = 1 LIMIT 1
0.319 ms 2 /classes/Product.php:3570
339
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2518) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.319 ms 1 /classes/stock/StockAvailable.php:453
562
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2425 LIMIT 1
0.319 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
609
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2314
0.319 ms 4 /classes/Product.php:3420
73
SELECT SQL_NO_CACHE data FROM och438layered_filter_block WHERE hash="fcef5de302327caede79853487535db9" LIMIT 1
0.318 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
169
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2665)
0.318 ms 1 /classes/Product.php:3860
633
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2542
0.318 ms 2 /classes/Product.php:3420
642
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2639
0.318 ms 4 /classes/Product.php:3420
652
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.318 ms 1 /classes/module/Module.php:2137
395
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2555
AND image_shop.`cover` = 1 LIMIT 1
0.318 ms 1 /classes/Product.php:3570
442
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2425
0.318 ms 1 /classes/Product.php:2899
606
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2312
0.318 ms 4 /classes/Product.php:3420
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2432)
0.317 ms 1 /classes/Product.php:3860
429
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2641)
0.317 ms 1 /classes/Product.php:3860
410
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2639 AND id_shop=1 LIMIT 1
0.316 ms 1 /classes/Product.php:6884
577
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2662 LIMIT 1
0.316 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
645
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2638
0.316 ms 3 /classes/Product.php:3420
111
SELECT SQL_NO_CACHE *
FROM `och438tax` a
WHERE (a.`id_tax` = 31) LIMIT 1
0.316 ms 1 /src/Adapter/EntityMapper.php:71
175
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2662
AND image_shop.`cover` = 1 LIMIT 1
0.315 ms 1 /classes/Product.php:3570
269
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1890
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.315 ms 1 /classes/SpecificPrice.php:256
438
SELECT SQL_NO_CACHE state FROM och438feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.315 ms 1 /classes/FeatureFlag.php:105
574
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2665 LIMIT 1
0.315 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2431)
0.314 ms 1 /classes/Product.php:3860
205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2453) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
567
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2456
0.314 ms 2 /classes/Product.php:3420
121
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.313 ms 1 /classes/Product.php:5670
336
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2518)
0.313 ms 1 /classes/Product.php:3860
347
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2538)
0.313 ms 1 /classes/Product.php:3860
389
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2553)
0.313 ms 1 /classes/Product.php:3860
132
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.312 ms 1 /classes/Product.php:5670
564
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2431
0.312 ms 2 /classes/Product.php:3420
598
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 1888 LIMIT 1
0.312 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
188
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2432 LIMIT 1
0.312 ms 1 /classes/SpecificPrice.php:435
407
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2639
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.312 ms 1 /classes/SpecificPrice.php:256
383
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.311 ms 1 /classes/stock/StockAvailable.php:453
618
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2496
0.311 ms 4 /classes/Product.php:3420
624
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2538
0.311 ms 2 /classes/Product.php:3420
639
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2555
0.311 ms 4 /classes/Product.php:3420
454
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2665
0.311 ms 1 /classes/Product.php:2899
59
SELECT SQL_NO_CACHE *
FROM `och438country` a
LEFT JOIN `och438country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.310 ms 1 /src/Adapter/EntityMapper.php:71
202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2453)
0.310 ms 1 /classes/Product.php:3860
256
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.310 ms 1 /classes/Product.php:5670
530
SELECT SQL_NO_CACHE c.id_elementor FROM och438iqit_elementor_category c WHERE c.id_category = 22 LIMIT 1
0.310 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
570
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2522
0.310 ms 2 /classes/Product.php:3420
214
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2430)
0.309 ms 1 /classes/Product.php:3860
594
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1889
0.309 ms 4 /classes/Product.php:3420
50
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 138) AND (b.`id_shop` = 1) LIMIT 1
0.308 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2665
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2453
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
640
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `och438iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 2555 LIMIT 1
0.307 ms 1 /modules/iqitreviews/src/IqitProductReview.php:113
651
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitelementor" LIMIT 1
0.307 ms 1 /classes/module/Module.php:2664
579
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2432
0.307 ms 2 /classes/Product.php:3420
120
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 41 LIMIT 1
0.306 ms 1 /classes/Category.php:1373
333
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2518
AND image_shop.`cover` = 1 LIMIT 1
0.306 ms 1 /classes/Product.php:3570
356
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2539
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.306 ms 1 /classes/SpecificPrice.php:256
582
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2453
0.306 ms 2 /classes/Product.php:3420
52
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 274) AND (b.`id_shop` = 1) LIMIT 1
0.305 ms 1 /src/Adapter/EntityMapper.php:71
53
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 275) AND (b.`id_shop` = 1) LIMIT 1
0.305 ms 1 /src/Adapter/EntityMapper.php:71
612
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2460
0.305 ms 3 /classes/Product.php:3420
615
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2467
0.304 ms 3 /classes/Product.php:3420
46
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 45) AND (b.`id_shop` = 1) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
537
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_languageselector" LIMIT 1
0.303 ms 1 /classes/module/Module.php:2664
534
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.303 ms 1 /classes/module/Module.php:2664
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2431 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6884
366
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2540 LIMIT 1
0.302 ms 1 /classes/SpecificPrice.php:435
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2456
AND image_shop.`cover` = 1 LIMIT 1
0.301 ms 1 /classes/Product.php:3570
345
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2538
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.301 ms 1 /classes/SpecificPrice.php:256
654
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_categorytree" LIMIT 1
0.301 ms 1 /classes/module/Module.php:2664
257
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1888 LIMIT 1
0.300 ms 1 /classes/SpecificPrice.php:435
176
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.299 ms 1 /classes/Product.php:5670
377
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2542 LIMIT 1
0.299 ms 1 /classes/SpecificPrice.php:435
439
SELECT SQL_NO_CACHE * FROM `och438image_type`
0.299 ms 8 /classes/ImageType.php:161
514
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2542
0.299 ms 1 /classes/Product.php:2899
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `och438hook_alias`
0.298 ms 88 /classes/Hook.php:290
306
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2460
AND image_shop.`cover` = 1 LIMIT 1
0.298 ms 3 /classes/Product.php:3570
324
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2496
AND image_shop.`cover` = 1 LIMIT 1
0.298 ms 2 /classes/Product.php:3570
576
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2662
0.298 ms 2 /classes/Product.php:3420
621
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 2518
0.298 ms 4 /classes/Product.php:3420
665
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.298 ms 1 /classes/module/Module.php:2137
309
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2460)
0.297 ms 1 /classes/Product.php:3860
326
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2496 LIMIT 1
0.297 ms 1 /classes/SpecificPrice.php:435
597
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1888
0.297 ms 4 /classes/Product.php:3420
300
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2314)
0.296 ms 1 /classes/Product.php:3860
542
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.295 ms 1 /classes/module/Module.php:2137
49
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1
0.295 ms 1 /src/Adapter/EntityMapper.php:71
123
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2425
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.295 ms 1 /classes/SpecificPrice.php:256
185
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2432
AND image_shop.`cover` = 1 LIMIT 1
0.295 ms 1 /classes/Product.php:3570
209
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 29 LIMIT 1
0.295 ms 1 /classes/Category.php:1373
344
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2538 LIMIT 1
0.295 ms 1 /classes/SpecificPrice.php:435
600
SELECT SQL_NO_CACHE `id_category` FROM `och438category_product`
WHERE `id_product` = 1890
0.295 ms 4 /classes/Product.php:3420
51
SELECT SQL_NO_CACHE *
FROM `och438category` a
LEFT JOIN `och438category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `och438category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 272) AND (b.`id_shop` = 1) LIMIT 1
0.294 ms 1 /src/Adapter/EntityMapper.php:71
223
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2510 LIMIT 1
0.294 ms 1 /classes/SpecificPrice.php:435
552
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.294 ms 1 /classes/module/Module.php:2664
376
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.293 ms 1 /classes/Product.php:5670
387
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.293 ms 1 /classes/Product.php:5670
545
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitsearch" LIMIT 1
0.293 ms 1 /classes/module/Module.php:2664
318
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2467)
0.293 ms 1 /classes/Product.php:3860
508
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2539
0.293 ms 1 /classes/Product.php:2899
282
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `och438product` p
INNER JOIN `och438product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `och438product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2305)
0.292 ms 1 /classes/Product.php:3860
412
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2639) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
550
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.292 ms 1 /classes/module/Module.php:2664
361
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2539) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.292 ms 1 /classes/stock/StockAvailable.php:453
541
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitwishlist" LIMIT 1
0.291 ms 1 /classes/module/Module.php:2664
189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2432
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.291 ms 1 /classes/SpecificPrice.php:256
288
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2312
AND image_shop.`cover` = 1 LIMIT 1
0.291 ms 4 /classes/Product.php:3570
451
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2522
0.290 ms 1 /classes/Product.php:2899
61
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM och438required_field
0.290 ms 1 /classes/ObjectModel.php:1592
388
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2553 LIMIT 1
0.290 ms 1 /classes/SpecificPrice.php:435
204
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2453 AND `id_group` = 1 LIMIT 1
0.289 ms 0 /classes/GroupReduction.php:153
511
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2540
0.289 ms 1 /classes/Product.php:2899
397
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2555 LIMIT 1
0.288 ms 1 /classes/SpecificPrice.php:435
95
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 42 LIMIT 1
0.287 ms 1 /classes/Category.php:1373
104
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2455
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.287 ms 1 /classes/SpecificPrice.php:256
520
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2555
0.287 ms 1 /classes/Product.php:2899
277
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2305
AND image_shop.`cover` = 1 LIMIT 1
0.287 ms 1 /classes/Product.php:3570
437
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2455
0.287 ms 1 /classes/Product.php:2899
523
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2639
0.287 ms 1 /classes/Product.php:2899
171
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2665 AND `id_group` = 1 LIMIT 1
0.286 ms 0 /classes/GroupReduction.php:153
315
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `och438image` i
INNER JOIN och438image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2467
AND image_shop.`cover` = 1 LIMIT 1
0.286 ms 1 /classes/Product.php:3570
367
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2540
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.286 ms 1 /classes/SpecificPrice.php:256
406
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2639 LIMIT 1
0.286 ms 1 /classes/SpecificPrice.php:435
540
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.286 ms 1 /classes/module/Module.php:2137
666
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitpopup" LIMIT 1
0.286 ms 1 /classes/module/Module.php:2664
372
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2540) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:453
543
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcompare" LIMIT 1
0.285 ms 1 /classes/module/Module.php:2664
558
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 83 AND `id_shop` = 1 LIMIT 1
0.285 ms 1 /classes/module/Module.php:2137
490
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2314
0.284 ms 1 /classes/Product.php:2899
466
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2430
0.284 ms 1 /classes/Product.php:2899
669
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.284 ms 1 /classes/module/Module.php:2137
155
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 33 LIMIT 1
0.283 ms 1 /classes/Category.php:1373
203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2453 AND id_shop=1 LIMIT 1
0.283 ms 1 /classes/Product.php:6884
392
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2553) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
401
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2555) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:453
481
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1890
0.283 ms 1 /classes/Product.php:2899
274
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1890) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.282 ms 1 /classes/stock/StockAvailable.php:453
457
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2662
0.282 ms 1 /classes/Product.php:2899
548
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_shoppingcart" LIMIT 1
0.282 ms 1 /classes/module/Module.php:2664
96
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 42 LIMIT 1
0.282 ms 1 /classes/Product.php:5670
163
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2522) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.282 ms 1 /classes/stock/StockAvailable.php:453
551
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.282 ms 1 /classes/module/Module.php:2137
285
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:453
103
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE `to` BETWEEN '2026-06-22 00:00:00' AND '2026-06-22 23:59:59' LIMIT 1
0.281 ms 1 /classes/SpecificPrice.php:381
133
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2431 LIMIT 1
0.281 ms 1 /classes/SpecificPrice.php:435
484
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2305
0.280 ms 1 /classes/Product.php:2899
539
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.280 ms 1 /classes/module/Module.php:2664
57
SELECT SQL_NO_CACHE format
FROM `och438address_format`
WHERE `id_country` = 6 LIMIT 1
0.280 ms 1 /classes/AddressFormat.php:653
122
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2425 LIMIT 1
0.280 ms 1 /classes/SpecificPrice.php:435
244
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 22 LIMIT 1
0.280 ms 1 /classes/Category.php:1373
423
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2638) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
478
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 1888
0.279 ms 1 /classes/Product.php:2899
55
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.279 ms 0 /classes/module/Module.php:2137
128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2425) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
157
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2522 LIMIT 1
0.279 ms 1 /classes/SpecificPrice.php:435
167
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.279 ms 1 /classes/Product.php:5670
246
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 1889 LIMIT 1
0.279 ms 1 /classes/SpecificPrice.php:435
350
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
428
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2641 LIMIT 1
0.279 ms 1 /classes/SpecificPrice.php:435
460
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2432
0.279 ms 1 /classes/Product.php:2899
463
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2453
0.279 ms 1 /classes/Product.php:2899
538
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.279 ms 1 /classes/module/Module.php:2137
553
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.279 ms 1 /classes/module/Module.php:2137
145
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2456 LIMIT 1
0.278 ms 1 /classes/SpecificPrice.php:435
299
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2314 LIMIT 1
0.278 ms 1 /classes/SpecificPrice.php:435
422
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2638 AND `id_group` = 1 LIMIT 1
0.278 ms 0 /classes/GroupReduction.php:153
544
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 69 AND `id_shop` = 1 LIMIT 1
0.278 ms 1 /classes/module/Module.php:2137
65
SELECT SQL_NO_CACHE `id_category`
FROM `och438category_shop`
WHERE `id_category` = 22
AND `id_shop` = 1 LIMIT 1
0.277 ms 1 /classes/Category.php:2446
149
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2456 AND id_shop=1 LIMIT 1
0.277 ms 1 /classes/Product.php:6884
151
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2456) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.277 ms 1 /classes/stock/StockAvailable.php:453
182
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2662) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.277 ms 1 /classes/stock/StockAvailable.php:453
229
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2510) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.277 ms 1 /classes/stock/StockAvailable.php:453
469
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2510
0.277 ms 1 /classes/Product.php:2899
493
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2460
0.277 ms 1 /classes/Product.php:2899
161
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2522 AND id_shop=1 LIMIT 1
0.277 ms 1 /classes/Product.php:6884
535
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.277 ms 1 /classes/module/Module.php:2137
668
SELECT SQL_NO_CACHE `id_module` FROM `och438module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.277 ms 1 /classes/module/Module.php:2664
667
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1
0.275 ms 1 /classes/module/Module.php:2137
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2431) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
172
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2665) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
240
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.275 ms 1 /classes/stock/StockAvailable.php:453
279
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2305 LIMIT 1
0.275 ms 1 /classes/SpecificPrice.php:435
496
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2467
0.275 ms 1 /classes/Product.php:2899
233
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.274 ms 1 /classes/Product.php:5670
168
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2665 LIMIT 1
0.274 ms 1 /classes/SpecificPrice.php:435
252
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1889) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.274 ms 1 /classes/stock/StockAvailable.php:453
418
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2638
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.274 ms 1 /classes/SpecificPrice.php:256
445
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2431
0.274 ms 1 /classes/Product.php:2899
546
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.273 ms 1 /classes/module/Module.php:2137
97
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 115
AND `active` = 1 LIMIT 1
0.272 ms 1 /classes/Manufacturer.php:312
359
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2539 AND id_shop=1 LIMIT 1
0.272 ms 1 /classes/Product.php:6884
663
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.272 ms 1 /classes/module/Module.php:2137
263
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 1888) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
337
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2518 AND id_shop=1 LIMIT 1
0.272 ms 1 /classes/Product.php:6884
417
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2638 LIMIT 1
0.272 ms 1 /classes/SpecificPrice.php:435
448
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2456
0.271 ms 1 /classes/Product.php:2899
472
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2521
0.271 ms 1 /classes/Product.php:2899
199
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2453 LIMIT 1
0.271 ms 1 /classes/SpecificPrice.php:435
146
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2456
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:256
178
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2662 LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:435
134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2431
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:256
212
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2430
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:256
308
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2460 LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:435
343
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
416
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
427
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.269 ms 1 /classes/Product.php:5670
221
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 44 LIMIT 1
0.268 ms 1 /classes/Category.php:1373
338
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2518 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:153
382
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2542 AND `id_group` = 1 LIMIT 1
0.268 ms 0 /classes/GroupReduction.php:153
396
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.268 ms 1 /classes/Product.php:5670
659
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `och438category` c
LEFT JOIN `och438category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 22 LIMIT 1
0.268 ms 1 /classes/Category.php:1584
245
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
290
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2312 LIMIT 1
0.267 ms 1 /classes/SpecificPrice.php:435
354
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.267 ms 1 /classes/Product.php:5670
390
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2553 AND id_shop=1 LIMIT 1
0.267 ms 1 /classes/Product.php:6884
432
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2641) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
505
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `och438product_attribute`
WHERE `id_product` = 2538
0.266 ms 1 /classes/Product.php:2899
267
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.265 ms 1 /classes/Product.php:5670
371
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2540 AND `id_group` = 1 LIMIT 1
0.265 ms 0 /classes/GroupReduction.php:153
234
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2521 LIMIT 1
0.264 ms 1 /classes/SpecificPrice.php:435
655
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.264 ms 1 /classes/module/Module.php:2137
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2432 AND id_shop=1 LIMIT 1
0.264 ms 1 /classes/Product.php:6884
660
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `och438category` c
WHERE c.`id_category` = 2 LIMIT 1
0.264 ms 1 /classes/Category.php:1589
156
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 33 LIMIT 1
0.263 ms 1 /classes/Product.php:5670
186
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `och438category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 26 LIMIT 1
0.263 ms 1 /classes/Category.php:1373
421
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2638 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6884
549
SELECT SQL_NO_CACHE `id_module` FROM `och438module_shop` WHERE `id_module` = 32 AND `id_shop` = 1 LIMIT 1
0.263 ms 1 /classes/module/Module.php:2137
127
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2425 AND `id_group` = 1 LIMIT 1
0.262 ms 0 /classes/GroupReduction.php:153
144
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 99
AND `active` = 1 LIMIT 1
0.262 ms 1 /classes/Manufacturer.php:312
158
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2522
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.262 ms 1 /classes/SpecificPrice.php:256
210
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.261 ms 1 /classes/Product.php:5670
330
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2496) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.261 ms 1 /classes/stock/StockAvailable.php:453
411
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2639 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:153
138
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2431 AND `id_group` = 1 LIMIT 1
0.261 ms 0 /classes/GroupReduction.php:153
235
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.261 ms 1 /classes/SpecificPrice.php:256
180
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2662 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6884
399
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2555 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6884
280
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.260 ms 1 /classes/SpecificPrice.php:256
348
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2538 AND id_shop=1 LIMIT 1
0.260 ms 1 /classes/Product.php:6884
250
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1889 AND id_shop=1 LIMIT 1
0.259 ms 1 /classes/Product.php:6884
150
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2456 AND `id_group` = 1 LIMIT 1
0.258 ms 0 /classes/GroupReduction.php:153
258
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 1888
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.258 ms 0 /classes/SpecificPrice.php:256
239
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2521 AND `id_group` = 1 LIMIT 1
0.258 ms 0 /classes/GroupReduction.php:153
301
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2314 AND id_shop=1 LIMIT 1
0.258 ms 1 /classes/Product.php:6884
316
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.258 ms 1 /classes/Product.php:5670
198
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 26 LIMIT 1
0.257 ms 1 /classes/Product.php:5670
292
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2312 AND id_shop=1 LIMIT 1
0.257 ms 1 /classes/Product.php:6884
143
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 41 LIMIT 1
0.256 ms 1 /classes/Product.php:5670
170
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2665 AND id_shop=1 LIMIT 1
0.256 ms 1 /classes/Product.php:6884
272
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1890 AND id_shop=1 LIMIT 1
0.256 ms 1 /classes/Product.php:6884
317
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2467 LIMIT 1
0.256 ms 1 /classes/SpecificPrice.php:435
334
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.256 ms 1 /classes/Product.php:5670
310
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2460 AND id_shop=1 LIMIT 1
0.255 ms 1 /classes/Product.php:6884
335
SELECT SQL_NO_CACHE 1 FROM `och438specific_price` WHERE id_product = 2518 LIMIT 1
0.255 ms 1 /classes/SpecificPrice.php:435
227
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2510 AND id_shop=1 LIMIT 1
0.255 ms 1 /classes/Product.php:6884
278
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.253 ms 1 /classes/Product.php:5670
391
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2553 AND `id_group` = 1 LIMIT 1
0.253 ms 0 /classes/GroupReduction.php:153
216
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2430 AND `id_group` = 1 LIMIT 1
0.252 ms 0 /classes/GroupReduction.php:153
222
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 44 LIMIT 1
0.252 ms 1 /classes/Product.php:5670
307
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.252 ms 1 /classes/Product.php:5670
430
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2641 AND id_shop=1 LIMIT 1
0.252 ms 1 /classes/Product.php:6884
238
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2521 AND id_shop=1 LIMIT 1
0.251 ms 1 /classes/Product.php:6884
162
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2522 AND `id_group` = 1 LIMIT 1
0.251 ms 0 /classes/GroupReduction.php:153
302
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2314 AND `id_group` = 1 LIMIT 1
0.251 ms 0 /classes/GroupReduction.php:153
294
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2312) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.250 ms 1 /classes/stock/StockAvailable.php:453
224
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2510
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.250 ms 1 /classes/SpecificPrice.php:256
262
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1888 AND `id_group` = 1 LIMIT 1
0.250 ms 0 /classes/GroupReduction.php:153
312
SELECT SQL_NO_CACHE SUM(quantity)
FROM `och438stock_available`
WHERE (id_product = 2460) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.249 ms 1 /classes/stock/StockAvailable.php:453
181
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2662 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:153
228
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2510 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:153
200
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `och438specific_price_priority`
WHERE `id_product` = 2453
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.246 ms 1 /classes/SpecificPrice.php:256
325
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.245 ms 1 /classes/Product.php:5670
177
SELECT SQL_NO_CACHE `name`
FROM `och438manufacturer`
WHERE `id_manufacturer` = 126
AND `active` = 1 LIMIT 1
0.244 ms 1 /classes/Manufacturer.php:312
187
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 26 LIMIT 1
0.244 ms 1 /classes/Product.php:5670
261
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 1888 AND id_shop=1 LIMIT 1
0.244 ms 1 /classes/Product.php:6884
289
SELECT SQL_NO_CACHE name FROM och438category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 22 LIMIT 1
0.244 ms 1 /classes/Product.php:5670
400
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2555 AND `id_group` = 1 LIMIT 1
0.244 ms 0 /classes/GroupReduction.php:153
320
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2467 AND `id_group` = 1 LIMIT 1
0.243 ms 0 /classes/GroupReduction.php:153
193
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2432 AND `id_group` = 1 LIMIT 1
0.242 ms 0 /classes/GroupReduction.php:153
329
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2496 AND `id_group` = 1 LIMIT 1
0.242 ms 0 /classes/GroupReduction.php:153
319
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2467 AND id_shop=1 LIMIT 1
0.241 ms 1 /classes/Product.php:6884
283
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `och438product_shop`
WHERE `id_product` = 2305 AND id_shop=1 LIMIT 1
0.240 ms 1 /classes/Product.php:6884
311
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2460 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:153
251
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1889 AND `id_group` = 1 LIMIT 1
0.238 ms 0 /classes/GroupReduction.php:153
284
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2305 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:153
431
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2641 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:153
349
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2538 AND `id_group` = 1 LIMIT 1
0.233 ms 0 /classes/GroupReduction.php:153
293
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 2312 AND `id_group` = 1 LIMIT 1
0.230 ms 0 /classes/GroupReduction.php:153
273
SELECT SQL_NO_CACHE `reduction`
FROM `och438product_group_reduction_cache`
WHERE `id_product` = 1890 AND `id_group` = 1 LIMIT 1
0.229 ms 0 /classes/GroupReduction.php:153

Doubles

32 queries
SELECT XX FROM `ochXXspecific_price` WHERE id_product = XX LIMIT XX
31 queries
SELECT image_shop.`id_image`
                    FROM `ochXXimage` i
                     INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
31 queries
SELECT name FROM ochXXcategory_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
31 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ochXXproduct` p
INNER JOIN `ochXXproduct_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `ochXXproduct_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
31 queries
                            SELECT `id_tax_rules_group`
                            FROM `ochXXproduct_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
31 queries
			SELECT `reduction`
			FROM `ochXXproduct_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
31 queries
SELECT SUM(quantity)
FROM `ochXXstock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
31 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `ochXXcart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `ochXXcart_product` cp JOIN `ochXXpack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ochXXproduct` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
31 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM ochXXfeature_product pf
                LEFT JOIN ochXXfeature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN ochXXfeature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN ochXXfeature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN ochXXfeature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
31 queries
SELECT *
FROM `ochXXproduct` a
LEFT JOIN `ochXXproduct_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `ochXXproduct_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
31 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `ochXXimage` i
             INNER JOIN ochXXimage_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `ochXXimage_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
31 queries
SELECT `id_product_attribute`
            FROM `ochXXproduct_attribute`
            WHERE `id_product` = XX
31 queries
                SELECT `id_category` FROM `ochXXcategory_product`
                WHERE `id_product` = XX
31 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `ochXXiqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
31 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `ochXXproduct_attribute` pa
             INNER JOIN ochXXproduct_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `ochXXproduct_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `ochXXattribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `ochXXattribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
20 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `ochXXspecific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
20 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `ochXXspecific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
18 queries
SELECT *
FROM `ochXXcategory` a
LEFT JOIN `ochXXcategory_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `ochXXcategory_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
18 queries
SELECT `id_module` FROM `ochXXmodule_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
7 queries
			SELECT cl.`link_rewrite`
			FROM `ochXXcategory_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `ochXXattribute_group` ag INNER JOIN `ochXXattribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `ochXXattribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `ochXXattribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN ochXXattribute_group_shop attribute_group_shop
        ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX)  INNER JOIN ochXXattribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `ochXXlayered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
4 queries
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN ochXXattribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=XX)) GROUP BY pac.id_attribute
3 queries
				SELECT `name`
				FROM `ochXXmanufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `ochXXmodule` m
                LEFT JOIN `ochXXmodule_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `ochXXlang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `ochXXcategory_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `ochXXmanufacturer` m INNER JOIN ochXXmanufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `ochXXmanufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ochXXproduct p LEFT JOIN ochXXproduct_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ochXXproduct_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ochXXstock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN ochXXproduct_sale psales ON (psales.id_product = p.id_product) INNER JOIN ochXXcategory_product cp ON (p.id_product = cp.id_product) INNER JOIN ochXXproduct_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN ochXXcategory c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN ochXXcategory_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND p.id_manufacturer IN (XX, XX, XX) AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN ochXXfeature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=XX)) GROUP BY fp.id_feature_value
2 queries
				SELECT tr.*
				FROM `ochXXtax_rule` tr
				JOIN `ochXXtax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT XX FROM `ochXXcart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

108 product
108 product_shop
78 product_attribute
65 category_lang
64 cart_product
62 image
62 image_shop
62 product_attribute_shop
57 specific_price
47 product_attribute_combination
47 category_product
44 stock_available
43 category
39 attribute
36 attribute_group
35 attribute_lang
33 feature_product
32 feature
32 feature_shop
32 feature_lang
32 product_lang
31 product_group_reduction_cache
31 pack
31 feature_value_lang
31 image_lang
31 iqitreviews_products
25 category_shop
22 module
21 module_shop
20 specific_price_priority
17 category_group
12 product_sale
7 hook
5 lang
5 currency
5 attribute_group_shop
5 attribute_group_lang
5 manufacturer
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 attribute_shop
4 layered_indexable_attribute_lang_value
3 country
3 hook_alias
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 manufacturer_shop
2 manufacturer_lang
2 tax_rule
2 tax_rules_group
2 iqit_elementor_category
2 cart_rule
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 layered_category
1 layered_indexable_attribute_group
1 layered_indexable_attribute_group_lang_value
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 tax
1 tax_lang
1 feature_flag
1 iqit_elementor_category_shop
1 connections
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 31 /src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2455]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2425]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2431]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2456]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2522]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2665]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2662]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2432]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2453]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2430]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2510]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2521]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1889]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1888]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1890]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2305]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2312]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2314]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2460]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2467]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2496]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2518]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2538]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2539]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2540]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2542]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2553]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2555]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2639]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2638]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2641]
Category 23 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 22]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 26]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 29]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 33]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 40]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 41]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 42]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 43]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 44]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 45]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 94]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 130]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 131]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 138]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 272]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 274]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 275]
/classes/Meta.php:379 (__construct) [id: 22]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 22]
/modules/ps_facetedsearch/src/Filters/Block.php:158 (__construct) [id: 22]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 0]
/classes/controller/FrontController.php:1768 (__construct) [id: 0]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
Tax 1 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 31]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /classes/Smarty/SmartyDev.php
199 /vendor/smarty/smarty/libs/Smarty.class.php
200 /vendor/smarty/smarty/libs/functions.php
201 /vendor/smarty/smarty/libs/Autoloader.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
211 /config/smartyfront.config.inc.php
212 /classes/Smarty/SmartyResourceModule.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
215 /classes/Smarty/SmartyResourceParent.php
216 /classes/Smarty/SmartyLazyRegister.php
217 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
218 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
219 /classes/Customer.php
220 /classes/Group.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /classes/Dispatcher.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
231 /src/Adapter/SymfonyContainer.php
232 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
233 /src/Adapter/ContainerBuilder.php
234 /src/Adapter/Environment.php
235 /src/Core/EnvironmentInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
237 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
238 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
239 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
240 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
241 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
245 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
246 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
247 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
248 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
249 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
250 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
252 /vendor/symfony/contracts/Service/ResetInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
255 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
256 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
258 /vendor/symfony/contracts/Cache/ItemInterface.php
259 /vendor/psr/cache/src/CacheItemInterface.php
260 /vendor/psr/cache/src/CacheItemPoolInterface.php
261 /vendor/symfony/contracts/Cache/CacheInterface.php
262 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
264 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
266 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
267 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
268 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
269 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
270 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
271 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
319 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
321 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
323 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
324 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
325 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
326 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
330 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
331 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
332 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
333 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
334 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
335 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
336 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
337 /var/cache/dev/FrontContainer.php
338 /src/Adapter/Container/LegacyContainer.php
339 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
340 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
341 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
342 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
343 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
344 /vendor/psr/container/src/ContainerExceptionInterface.php
345 /vendor/psr/container/src/NotFoundExceptionInterface.php
346 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
347 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
348 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
349 /src/Adapter/Container/LegacyContainerInterface.php
350 /modules/blockwishlist/vendor/autoload.php
351 /modules/blockwishlist/vendor/composer/autoload_real.php
352 /modules/blockwishlist/vendor/composer/autoload_static.php
353 /modules/contactform/vendor/autoload.php
354 /modules/contactform/vendor/composer/autoload_real.php
355 /modules/contactform/vendor/composer/autoload_static.php
356 /modules/dashactivity/vendor/autoload.php
357 /modules/dashactivity/vendor/composer/autoload_real.php
358 /modules/dashactivity/vendor/composer/platform_check.php
359 /modules/dashactivity/vendor/composer/autoload_static.php
360 /modules/dashtrends/vendor/autoload.php
361 /modules/dashtrends/vendor/composer/autoload_real.php
362 /modules/dashtrends/vendor/composer/autoload_static.php
363 /modules/dashgoals/vendor/autoload.php
364 /modules/dashgoals/vendor/composer/autoload_real.php
365 /modules/dashgoals/vendor/composer/platform_check.php
366 /modules/dashgoals/vendor/composer/autoload_static.php
367 /modules/dashproducts/vendor/autoload.php
368 /modules/dashproducts/vendor/composer/autoload_real.php
369 /modules/dashproducts/vendor/composer/platform_check.php
370 /modules/dashproducts/vendor/composer/autoload_static.php
371 /modules/graphnvd3/vendor/autoload.php
372 /modules/graphnvd3/vendor/composer/autoload_real.php
373 /modules/graphnvd3/vendor/composer/autoload_static.php
374 /modules/gridhtml/vendor/autoload.php
375 /modules/gridhtml/vendor/composer/autoload_real.php
376 /modules/gridhtml/vendor/composer/autoload_static.php
377 /modules/gsitemap/vendor/autoload.php
378 /modules/gsitemap/vendor/composer/autoload_real.php
379 /modules/gsitemap/vendor/composer/platform_check.php
380 /modules/gsitemap/vendor/composer/autoload_static.php
381 /modules/pagesnotfound/vendor/autoload.php
382 /modules/pagesnotfound/vendor/composer/autoload_real.php
383 /modules/pagesnotfound/vendor/composer/platform_check.php
384 /modules/pagesnotfound/vendor/composer/autoload_static.php
385 /modules/productcomments/vendor/autoload.php
386 /modules/productcomments/vendor/composer/autoload_real.php
387 /modules/productcomments/vendor/composer/platform_check.php
388 /modules/productcomments/vendor/composer/autoload_static.php
389 /modules/ps_categorytree/vendor/autoload.php
390 /modules/ps_categorytree/vendor/composer/autoload_real.php
391 /modules/ps_categorytree/vendor/composer/platform_check.php
392 /modules/ps_categorytree/vendor/composer/autoload_static.php
393 /modules/ps_checkpayment/vendor/autoload.php
394 /modules/ps_checkpayment/vendor/composer/autoload_real.php
395 /modules/ps_checkpayment/vendor/composer/autoload_static.php
396 /modules/ps_crossselling/vendor/autoload.php
397 /modules/ps_crossselling/vendor/composer/autoload_real.php
398 /modules/ps_crossselling/vendor/composer/platform_check.php
399 /modules/ps_crossselling/vendor/composer/autoload_static.php
400 /modules/ps_currencyselector/vendor/autoload.php
401 /modules/ps_currencyselector/vendor/composer/autoload_real.php
402 /modules/ps_currencyselector/vendor/composer/autoload_static.php
403 /modules/ps_customeraccountlinks/vendor/autoload.php
404 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
405 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
406 /modules/ps_customersignin/vendor/autoload.php
407 /modules/ps_customersignin/vendor/composer/autoload_real.php
408 /modules/ps_customersignin/vendor/composer/autoload_static.php
409 /modules/ps_dataprivacy/vendor/autoload.php
410 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
411 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
412 /modules/ps_emailsubscription/vendor/autoload.php
413 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
414 /modules/ps_emailsubscription/vendor/composer/platform_check.php
415 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
416 /modules/ps_faviconnotificationbo/vendor/autoload.php
417 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
418 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
419 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
420 /modules/ps_languageselector/vendor/autoload.php
421 /modules/ps_languageselector/vendor/composer/autoload_real.php
422 /modules/ps_languageselector/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_wirepayment/vendor/autoload.php
430 /modules/ps_wirepayment/vendor/composer/autoload_real.php
431 /modules/ps_wirepayment/vendor/composer/platform_check.php
432 /modules/ps_wirepayment/vendor/composer/autoload_static.php
433 /modules/statsbestcategories/vendor/autoload.php
434 /modules/statsbestcategories/vendor/composer/autoload_real.php
435 /modules/statsbestcategories/vendor/composer/platform_check.php
436 /modules/statsbestcategories/vendor/composer/autoload_static.php
437 /modules/statsbestcustomers/vendor/autoload.php
438 /modules/statsbestcustomers/vendor/composer/autoload_real.php
439 /modules/statsbestcustomers/vendor/composer/platform_check.php
440 /modules/statsbestcustomers/vendor/composer/autoload_static.php
441 /modules/statsbestproducts/vendor/autoload.php
442 /modules/statsbestproducts/vendor/composer/autoload_real.php
443 /modules/statsbestproducts/vendor/composer/platform_check.php
444 /modules/statsbestproducts/vendor/composer/autoload_static.php
445 /modules/statsbestsuppliers/vendor/autoload.php
446 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
447 /modules/statsbestsuppliers/vendor/composer/platform_check.php
448 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
449 /modules/statsbestvouchers/vendor/autoload.php
450 /modules/statsbestvouchers/vendor/composer/autoload_real.php
451 /modules/statsbestvouchers/vendor/composer/platform_check.php
452 /modules/statsbestvouchers/vendor/composer/autoload_static.php
453 /modules/statscarrier/vendor/autoload.php
454 /modules/statscarrier/vendor/composer/autoload_real.php
455 /modules/statscarrier/vendor/composer/platform_check.php
456 /modules/statscarrier/vendor/composer/autoload_static.php
457 /modules/statscatalog/vendor/autoload.php
458 /modules/statscatalog/vendor/composer/autoload_real.php
459 /modules/statscatalog/vendor/composer/platform_check.php
460 /modules/statscatalog/vendor/composer/autoload_static.php
461 /modules/statscheckup/vendor/autoload.php
462 /modules/statscheckup/vendor/composer/autoload_real.php
463 /modules/statscheckup/vendor/composer/platform_check.php
464 /modules/statscheckup/vendor/composer/autoload_static.php
465 /modules/statsdata/vendor/autoload.php
466 /modules/statsdata/vendor/composer/autoload_real.php
467 /modules/statsdata/vendor/composer/autoload_static.php
468 /modules/statsforecast/vendor/autoload.php
469 /modules/statsforecast/vendor/composer/autoload_real.php
470 /modules/statsforecast/vendor/composer/platform_check.php
471 /modules/statsforecast/vendor/composer/autoload_static.php
472 /modules/statsnewsletter/vendor/autoload.php
473 /modules/statsnewsletter/vendor/composer/autoload_real.php
474 /modules/statsnewsletter/vendor/composer/platform_check.php
475 /modules/statsnewsletter/vendor/composer/autoload_static.php
476 /modules/statspersonalinfos/vendor/autoload.php
477 /modules/statspersonalinfos/vendor/composer/autoload_real.php
478 /modules/statspersonalinfos/vendor/composer/platform_check.php
479 /modules/statspersonalinfos/vendor/composer/autoload_static.php
480 /modules/statsproduct/vendor/autoload.php
481 /modules/statsproduct/vendor/composer/autoload_real.php
482 /modules/statsproduct/vendor/composer/platform_check.php
483 /modules/statsproduct/vendor/composer/autoload_static.php
484 /modules/statsregistrations/vendor/autoload.php
485 /modules/statsregistrations/vendor/composer/autoload_real.php
486 /modules/statsregistrations/vendor/composer/platform_check.php
487 /modules/statsregistrations/vendor/composer/autoload_static.php
488 /modules/statssales/vendor/autoload.php
489 /modules/statssales/vendor/composer/autoload_real.php
490 /modules/statssales/vendor/composer/platform_check.php
491 /modules/statssales/vendor/composer/autoload_static.php
492 /modules/statssearch/vendor/autoload.php
493 /modules/statssearch/vendor/composer/autoload_real.php
494 /modules/statssearch/vendor/composer/platform_check.php
495 /modules/statssearch/vendor/composer/autoload_static.php
496 /modules/statsstock/vendor/autoload.php
497 /modules/statsstock/vendor/composer/autoload_real.php
498 /modules/statsstock/vendor/composer/platform_check.php
499 /modules/statsstock/vendor/composer/autoload_static.php
500 /modules/psgdpr/vendor/autoload.php
501 /modules/psgdpr/vendor/composer/autoload_real.php
502 /modules/psgdpr/vendor/composer/autoload_static.php
503 /modules/ps_facetedsearch/vendor/autoload.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
505 /modules/ps_facetedsearch/vendor/composer/platform_check.php
506 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
507 /modules/iqitsociallogin/vendor/autoload.php
508 /modules/iqitsociallogin/vendor/composer/autoload_real.php
509 /modules/iqitsociallogin/vendor/composer/platform_check.php
510 /modules/iqitsociallogin/vendor/composer/autoload_static.php
511 /modules/ps_emailalerts/vendor/autoload.php
512 /modules/ps_emailalerts/vendor/composer/autoload_real.php
513 /modules/ps_emailalerts/vendor/composer/autoload_static.php
514 /modules/ps_googleanalytics/vendor/autoload.php
515 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
516 /modules/ps_googleanalytics/vendor/composer/platform_check.php
517 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
518 /modules/ph_simpleblog/vendor/autoload.php
519 /modules/ph_simpleblog/vendor/composer/autoload_real.php
520 /modules/ph_simpleblog/vendor/composer/platform_check.php
521 /modules/ph_simpleblog/vendor/composer/autoload_static.php
522 /modules/autoupgrade/vendor/autoload.php
523 /modules/autoupgrade/vendor/composer/autoload_real.php
524 /modules/autoupgrade/vendor/composer/autoload_static.php
525 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
526 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
527 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
528 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
529 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
530 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
531 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
532 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
533 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
534 /modules/iqitproductflags/vendor/autoload.php
535 /modules/iqitproductflags/vendor/composer/autoload_real.php
536 /modules/iqitproductflags/vendor/composer/platform_check.php
537 /modules/iqitproductflags/vendor/composer/autoload_static.php
538 /modules/iqitproductvariants/vendor/autoload.php
539 /modules/iqitproductvariants/vendor/composer/autoload_real.php
540 /modules/iqitproductvariants/vendor/composer/autoload_static.php
541 /src/Core/Hook/HookModuleFilter.php
542 /src/Core/Hook/HookModuleFilterInterface.php
543 /modules/ph_simpleblog/ph_simpleblog.php
544 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
545 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
546 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
547 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
548 /modules/ph_simpleblog/models/SimpleBlogCategory.php
549 /modules/ph_simpleblog/models/SimpleBlogPost.php
550 /modules/ph_simpleblog/models/SimpleBlogPostType.php
551 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
552 /modules/ph_simpleblog/models/SimpleBlogTag.php
553 /modules/ph_simpleblog/models/SimpleBlogComment.php
554 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
555 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
556 /modules/ph_simpleblog/classes/BlogPostsFinder.php
557 /modules/ph_simpleblog/controllers/front/default_list.php
558 /classes/controller/ModuleFrontController.php
559 /override/classes/controller/FrontController.php
560 /classes/controller/FrontController.php
561 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
562 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
563 /classes/Translate.php
564 /modules/ph_simpleblog/translations/es.php
565 /src/PrestaShopBundle/Translation/TranslatorComponent.php
566 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
567 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
568 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
569 /vendor/symfony/contracts/Translation/TranslatorInterface.php
570 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
571 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
572 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
573 /src/PrestaShopBundle/Translation/TranslatorInterface.php
574 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
575 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
576 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
577 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
578 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
579 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
580 /vendor/symfony/contracts/Translation/TranslatorTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
582 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
583 /var/cache/dev/translations/catalogue.es-ES.NXhscRe.php
584 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
585 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
587 /controllers/front/listing/CategoryController.php
588 /classes/controller/ProductListingFrontController.php
589 /classes/controller/ProductPresentingFrontController.php
590 /src/Adapter/Presenter/Object/ObjectPresenter.php
591 /src/Adapter/Presenter/PresenterInterface.php
592 /src/Adapter/Presenter/Cart/CartPresenter.php
593 /src/Adapter/Image/ImageRetriever.php
594 /classes/tax/TaxConfiguration.php
595 /classes/Smarty/TemplateFinder.php
596 /classes/assets/StylesheetManager.php
597 /classes/assets/AbstractAssetManager.php
598 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
599 /classes/assets/JavascriptManager.php
600 /classes/assets/CccReducer.php
601 /modules/iqitthemeeditor/iqitthemeeditor.php
602 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
603 /modules/iqitthemeeditor/translations/es.php
604 /classes/Category.php
605 /classes/webservice/WebserviceRequest.php
606 /src/Core/Localization/Locale/Repository.php
607 /src/Core/Localization/Locale/RepositoryInterface.php
608 /src/Core/Localization/CLDR/LocaleRepository.php
609 /src/Core/Localization/CLDR/LocaleDataSource.php
610 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
611 /src/Core/Data/Layer/AbstractDataLayer.php
612 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
613 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
614 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
615 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
616 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
617 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
618 /vendor/symfony/contracts/Cache/CacheTrait.php
619 /vendor/psr/cache/src/InvalidArgumentException.php
620 /vendor/psr/cache/src/CacheException.php
621 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
622 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
623 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
624 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
625 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
626 /src/Core/Localization/CLDR/Reader.php
627 /src/Core/Localization/CLDR/ReaderInterface.php
628 /src/Core/Localization/Currency/Repository.php
629 /src/Core/Localization/Currency/RepositoryInterface.php
630 /src/Core/Localization/Currency/CurrencyDataSource.php
631 /src/Core/Localization/Currency/DataSourceInterface.php
632 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
633 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
634 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
635 /src/Adapter/Currency/CurrencyDataProvider.php
636 /src/Core/Currency/CurrencyDataProviderInterface.php
637 /src/Adapter/LegacyContext.php
638 /src/Adapter/Tools.php
639 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
640 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
641 /vendor/prestashop/decimal/src/Operation/Rounding.php
642 /src/Core/Localization/Locale.php
643 /src/Core/Localization/LocaleInterface.php
644 /src/Core/Localization/Specification/Price.php
645 /src/Core/Localization/Specification/Number.php
646 /src/Core/Localization/Specification/NumberInterface.php
647 /src/Core/Localization/Specification/Factory.php
648 /src/Core/Localization/CLDR/LocaleData.php
649 /src/Core/Localization/CLDR/NumberSymbolsData.php
650 /src/Core/Localization/CLDR/CurrencyData.php
651 /src/Core/Localization/CLDR/Locale.php
652 /src/Core/Localization/CLDR/LocaleInterface.php
653 /src/Core/Localization/Specification/NumberSymbolList.php
654 /classes/Currency.php
655 /src/Core/Localization/Currency/LocalizedCurrencyId.php
656 /src/Core/Localization/Currency/CurrencyData.php
657 /src/Core/Localization/Currency/CurrencyCollection.php
658 /src/Core/Localization/Currency.php
659 /src/Core/Localization/CurrencyInterface.php
660 /src/Core/Localization/Specification/NumberCollection.php
661 /src/Core/Localization/Number/Formatter.php
662 /override/classes/Cart.php
663 /classes/Cart.php
664 /src/Adapter/AddressFactory.php
665 /override/classes/CartRule.php
666 /classes/CartRule.php
667 /classes/Product.php
668 /src/Core/Domain/Product/ValueObject/RedirectType.php
669 /src/Core/Util/DateTime/DateTime.php
670 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
671 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
672 /src/Core/Domain/Product/ValueObject/ProductType.php
673 /src/Core/Domain/Product/ValueObject/Reference.php
674 /src/Core/Domain/Product/ValueObject/Ean13.php
675 /src/Core/Domain/Product/ValueObject/Isbn.php
676 /src/Core/Domain/Product/ValueObject/Upc.php
677 /src/Core/Domain/Product/ProductSettings.php
678 /src/Core/Domain/Shop/ValueObject/ShopId.php
679 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
680 /modules/ps_emailsubscription/ps_emailsubscription.php
681 /src/Core/Module/WidgetInterface.php
682 /src/PrestaShopBundle/Translation/DomainNormalizer.php
683 /classes/Media.php
684 /modules/ps_emailalerts/ps_emailalerts.php
685 /modules/ps_emailalerts/MailAlert.php
686 /modules/iqitproductvariants/iqitproductvariants.php
687 /src/Adapter/Localization/LegacyTranslator.php
688 /src/Adapter/Presenter/Cart/CartLazyArray.php
689 /src/Adapter/Presenter/AbstractLazyArray.php
690 /src/Adapter/Product/PriceFormatter.php
691 /src/Core/Util/Inflector.php
692 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
693 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
694 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
695 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
696 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
697 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
698 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
699 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
700 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
701 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
702 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
703 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
704 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
705 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
706 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
707 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
708 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
709 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
710 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
711 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
712 /classes/Gender.php
713 /classes/Risk.php
714 /classes/Meta.php
715 /modules/revsliderprestashop/revsliderprestashop.php
716 /modules/revsliderprestashop/rev-loader.php
717 /modules/revsliderprestashop/includes/revslider_db.class.php
718 /modules/revsliderprestashop/includes/data.class.php
719 /modules/revsliderprestashop/includes/functions.class.php
720 /modules/revsliderprestashop/includes/em-integration.class.php
721 /modules/revsliderprestashop/includes/cssparser.class.php
722 /modules/revsliderprestashop/includes/woocommerce.class.php
723 /modules/revsliderprestashop/includes/wpml.class.php
724 /modules/revsliderprestashop/includes/colorpicker.class.php
725 /modules/revsliderprestashop/includes/navigation.class.php
726 /modules/revsliderprestashop/includes/object-library.class.php
727 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
728 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
729 /modules/revsliderprestashop/includes/extension.class.php
730 /modules/revsliderprestashop/includes/favorite.class.php
731 /modules/revsliderprestashop/includes/aq-resizer.class.php
732 /modules/revsliderprestashop/includes/external-sources.class.php
733 /modules/revsliderprestashop/includes/page-template.class.php
734 /modules/revsliderprestashop/includes/slider.class.php
735 /modules/revsliderprestashop/includes/slide.class.php
736 /modules/revsliderprestashop/includes/output.class.php
737 /modules/revsliderprestashop/public/revslider-front.class.php
738 /modules/revsliderprestashop/includes/backwards.php
739 /modules/revsliderprestashop/admin/includes/class-pclzip.php
740 /modules/revsliderprestashop/admin/includes/license.class.php
741 /modules/revsliderprestashop/admin/includes/addons.class.php
742 /modules/revsliderprestashop/admin/includes/template.class.php
743 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
744 /modules/revsliderprestashop/admin/includes/folder.class.php
745 /modules/revsliderprestashop/admin/includes/import.class.php
746 /modules/revsliderprestashop/admin/includes/export.class.php
747 /modules/revsliderprestashop/admin/includes/export-html.class.php
748 /modules/revsliderprestashop/admin/includes/newsletter.class.php
749 /modules/revsliderprestashop/admin/revslider-admin.class.php
750 /modules/revsliderprestashop/includes/update.class.php
751 /modules/revsliderprestashop/includes/resize-imag.php
752 /modules/revsliderprestashop/translations/es.php
753 /classes/Address.php
754 /classes/ImageType.php
755 /classes/State.php
756 /src/Core/Security/PasswordPolicyConfiguration.php
757 /src/Core/Configuration/DataConfigurationInterface.php
758 /src/Core/Filter/FrontEndObject/MainFilter.php
759 /src/Core/Filter/FilterInterface.php
760 /src/Core/Filter/FrontEndObject/CartFilter.php
761 /src/Core/Filter/HashMapWhitelistFilter.php
762 /src/Core/Filter/CollectionFilter.php
763 /src/Core/Filter/FrontEndObject/ProductFilter.php
764 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
765 /src/Core/Filter/FrontEndObject/CustomerFilter.php
766 /src/Core/Filter/FrontEndObject/ShopFilter.php
767 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
768 /modules/productcomments/productcomments.php
769 /modules/ps_shoppingcart/ps_shoppingcart.php
770 /modules/iqitcontactpage/iqitcontactpage.php
771 /modules/iqitcontactpage/translations/es.php
772 /modules/iqitcookielaw/iqitcookielaw.php
773 /modules/iqitcookielaw/translations/es.php
774 /modules/iqitcountdown/iqitcountdown.php
775 /modules/iqitcountdown/translations/es.php
776 /modules/iqitsociallogin/iqitsociallogin.php
777 /modules/iqitsociallogin/translations/es.php
778 /modules/ps_googleanalytics/ps_googleanalytics.php
779 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
780 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
781 /classes/Smarty/SmartyDevTemplate.php
782 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
783 /var/cache/dev/smarty/compile/warehouse/7f/93/a7/7f93a70bcc26a0e15d5a8f0ad7b21b4b42ad15c2_2.file.ps_googleanalytics.tpl.php
784 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
785 /classes/assets/PrestashopAssetsLibraries.php
786 /modules/iqitsizecharts/iqitsizecharts.php
787 /modules/iqitsizecharts/src/IqitSizeCharts.php
788 /modules/iqitsizecharts/translations/es.php
789 /modules/iqitwishlist/iqitwishlist.php
790 /modules/iqitwishlist/src/IqitWishlistProduct.php
791 /modules/iqitwishlist/translations/es.php
792 /modules/iqitreviews/iqitreviews.php
793 /modules/iqitreviews/src/IqitProductReview.php
794 /modules/iqitreviews/translations/es.php
795 /modules/iqitpopup/iqitpopup.php
796 /modules/iqitpopup/translations/es.php
797 /modules/iqitmegamenu/iqitmegamenu.php
798 /modules/iqitmegamenu/models/IqitMenuTab.php
799 /modules/iqitmegamenu/models/IqitMenuHtml.php
800 /modules/iqitmegamenu/models/IqitMenuLinks.php
801 /modules/iqitmegamenu/translations/es.php
802 /modules/iqitcompare/iqitcompare.php
803 /modules/iqitcompare/translations/es.php
804 /modules/iqitelementor/iqitelementor.php
805 /modules/iqitelementor/src/IqitElementorLanding.php
806 /modules/iqitelementor/src/IqitElementorTemplate.php
807 /modules/iqitelementor/src/IqitElementorProduct.php
808 /modules/iqitelementor/src/IqitElementorCategory.php
809 /modules/iqitelementor/src/IqitElementorContent.php
810 /modules/iqitelementor/src/iqitElementorWpHelper.php
811 /modules/iqitelementor/includes/plugin-elementor.php
812 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
813 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
814 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
815 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
816 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
817 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
818 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
819 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
820 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
821 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
822 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
823 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
824 /modules/iqitelementor/translations/es.php
825 /modules/iqitextendedproduct/iqitextendedproduct.php
826 /modules/iqitextendedproduct/src/IqitThreeSixty.php
827 /modules/iqitextendedproduct/src/IqitProductVideo.php
828 /modules/iqitextendedproduct/translations/es.php
829 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
830 /modules/iqitfreedeliverycount/translations/es.php
831 /src/Core/Product/Search/ProductSearchContext.php
832 /src/Core/Product/Search/ProductSearchQuery.php
833 /src/Core/Product/Search/SortOrder.php
834 /modules/ps_facetedsearch/ps_facetedsearch.php
835 /modules/ps_facetedsearch/src/HookDispatcher.php
836 /modules/ps_facetedsearch/src/Hook/Attribute.php
837 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
838 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
839 /modules/ps_facetedsearch/src/Hook/Category.php
840 /modules/ps_facetedsearch/src/Hook/Configuration.php
841 /modules/ps_facetedsearch/src/Hook/Design.php
842 /modules/ps_facetedsearch/src/Hook/Feature.php
843 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
844 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
845 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
846 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
847 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
848 /modules/ps_facetedsearch/src/Hook/Product.php
849 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
850 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
851 /modules/ps_facetedsearch/src/Filters/Provider.php
852 /modules/ps_facetedsearch/src/URLSerializer.php
853 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
854 /modules/ps_facetedsearch/src/Product/SearchProvider.php
855 /src/Core/Product/Search/FacetsRendererInterface.php
856 /src/Core/Product/Search/ProductSearchProviderInterface.php
857 /modules/ps_facetedsearch/src/Filters/Converter.php
858 /modules/ps_facetedsearch/src/Product/SearchFactory.php
859 /src/Core/Product/Search/ProductSearchResult.php
860 /classes/Combination.php
861 /classes/Manufacturer.php
862 /src/Core/Util/String/StringModifier.php
863 /src/Core/Util/String/StringModifierInterface.php
864 /modules/ps_facetedsearch/src/Product/Search.php
865 /modules/ps_facetedsearch/src/Adapter/MySQL.php
866 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
867 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
868 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
869 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
870 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
871 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
872 /modules/ps_facetedsearch/src/Filters/Products.php
873 /classes/stock/StockAvailable.php
874 /modules/ps_facetedsearch/src/Filters/Block.php
875 /src/Core/Product/Search/Facet.php
876 /src/Core/Product/Search/Filter.php
877 /vendor/prestashop/decimal/src/DecimalNumber.php
878 /vendor/prestashop/decimal/src/Builder.php
879 /src/Core/Product/Search/FacetCollection.php
880 /classes/ProductAssembler.php
881 /classes/tax/Tax.php
882 /classes/SpecificPrice.php
883 /classes/tax/TaxManagerFactory.php
884 /classes/tax/TaxRulesTaxManager.php
885 /classes/tax/TaxManagerInterface.php
886 /classes/tax/TaxCalculator.php
887 /classes/GroupReduction.php
888 /src/Core/Localization/CLDR/ComputingPrecision.php
889 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
890 /classes/Pack.php
891 /classes/order/Order.php
892 /classes/Feature.php
893 /classes/ProductPresenterFactory.php
894 /src/Adapter/Presenter/Product/ProductListingPresenter.php
895 /src/Adapter/Presenter/Product/ProductPresenter.php
896 /src/Adapter/Product/ProductColorsRetriever.php
897 /src/Adapter/HookManager.php
898 /src/Core/Product/ProductPresentationSettings.php
899 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
900 /src/Adapter/Presenter/Product/ProductLazyArray.php
901 /classes/Image.php
902 /src/Core/Image/ImageFormatConfiguration.php
903 /src/Core/Image/ImageFormatConfigurationInterface.php
904 /classes/FeatureFlag.php
905 /src/Core/FeatureFlag/FeatureFlagSettings.php
906 /classes/ImageManager.php
907 /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
908 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
909 /vendor/smarty/smarty/libs/plugins/modifier.count.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
912 /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
913 /src/Core/Product/Search/Pagination.php
914 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/a2/ac/10a2acb40a62faa7d4acf2ff79326cb9143364b9_2.file.category.tpl.php
915 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
916 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/7b/44/3b7b442e5be09f725564779ed89a7b73454120cc_2.file.product-list.tpl.php
917 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7b/05/e6/7b05e63eca4eeeca1407af0182fcc5f72eca6296_2.file.layout-left-column.tpl.php
918 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/dd/6f/fedd6f2f1c5383ca8f7a88001e645ec51798686f_2.file.layout-both-columns.tpl.php
919 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9f/7e/4a/9f7e4a2a31953c1ffd9af92c83bd91c1f3cd2c35_2.file.helpers.tpl.php
920 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
921 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/44/bf/b0/44bfb034c1f795379c422b7f1f9e16fbdd438c93_2.file.head.tpl.php
922 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/74/6f/a3/746fa3dd2b21e5f8274bb1f50aedff4595bb552e_2.file.head-jsonld.tpl.php
923 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/8d/80/d08d80bb870efd73dd55124817cbf5d770e7f7b2_2.file.product-list-jsonld.tpl.php
924 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/56/86/bf/5686bf9c07020fd395790a361d8976132a2fc4be_2.file.pagination-seo.tpl.php
925 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
926 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/93/e8/ed/93e8edeadb416f4f6abcf2d2b76fb0f54d0eba3d_2.file.stylesheets.tpl.php
927 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/af/76/c2af76b01726147ed1ded7543d0fd920339756bf_2.file.javascript.tpl.php
928 /classes/ProductDownload.php
929 /src/Core/Cart/Calculator.php
930 /src/Core/Cart/CartRowCollection.php
931 /src/Core/Cart/Fees.php
932 /src/Core/Cart/AmountImmutable.php
933 /src/Core/Cart/CartRuleCollection.php
934 /src/Core/Cart/CartRuleCalculator.php
935 /src/Adapter/Product/PriceCalculator.php
936 /src/Core/Cart/CartRow.php
937 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
938 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3b/0d/00/3b0d00bced40dc74d264c896b3629516dca0a06b_2.file.product-activation.tpl.php
939 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d0/2a/1d/d02a1d5aa2fc8a2b372e76425c1d49b597137881_2.file.header.tpl.php
940 /modules/iqitlinksmanager/iqitlinksmanager.php
941 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
942 /modules/iqitlinksmanager/src/IqitLinkBlock.php
943 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
944 /modules/iqitlinksmanager/translations/es.php
945 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
946 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
947 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
948 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
949 /modules/ps_languageselector/ps_languageselector.php
950 /modules/ps_currencyselector/ps_currencyselector.php
951 /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
952 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/54/66/f65466132945e631eb8304d318e35f83d75d651e_2.file.header-2.tpl.php
953 /modules/iqitsearch/iqitsearch.php
954 /modules/iqitsearch/translations/es.php
955 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
956 /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
957 /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
958 /modules/ps_customersignin/ps_customersignin.php
959 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
960 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
961 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
962 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
963 /var/cache/dev/smarty/compile/warehouse/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
964 /var/cache/dev/smarty/compile/warehouse/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
965 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/a0/a9/c9/a0a9c936f74308bdc1809002e948b8c26b0f5101.iqitmegamenuviewstemplateshookhorizontal.tpl.php
966 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/32/0c/d5/320cd56ae00cdb0df3cfaafda14dd79eef879159_2.file.mobile-header-2.tpl.php
967 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
968 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
969 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
970 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/88/01/f3/8801f3aef6612da9973e6f09844670ad2455b33c_2.file.breadcrumb.tpl.php
971 /modules/iqitproductsnav/iqitproductsnav.php
972 /modules/iqitproductsnav/translations/es.php
973 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/50/cf/2150cf9c7d24917c3322283d8d2a9798a55f33e1_2.file.notifications.tpl.php
974 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/39/dd/35/39dd3579b0d411714a13183f74f90657d9b16218_2.file.category-header.tpl.php
975 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/dc/dd/42/dcdd424ea5bdc2c731edea74e82e1b9752018d7f_2.file.products-top.tpl.php
976 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
977 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/f8/f7/e0f8f73bf2628e2a1784900d2234f9911a72566f_2.file.sort-orders.tpl.php
978 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/01/2d/6a/012d6af2272aef31c4959b70cb660dbba790eea4_2.file.pagination.tpl.php
979 /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
980 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e1/47/0e/e1470e491391572ac54700f0cafe332fed74977f_2.file.products.tpl.php
981 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/df/f3/21dff30aa3f82bc080b677e35ebedc1ec9a53690_2.file.product.tpl.php
982 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b2/b6/ab/b2b6ab658128da2281b45debedef04ba4285e0d8_2.file.product-miniature-1.tpl.php
983 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/70/ad/8b/70ad8bf895d617e9f5f73f4ce8c2c56d5c17c215_2.file.product-miniature-thumb.tpl.php
984 /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
985 /var/cache/dev/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
986 /modules/iqitproductflags/iqitproductflags.php
987 /src/Adapter/ContainerFinder.php
988 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php
989 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php
990 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php
991 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php
992 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php
993 /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php
994 /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php
995 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php
996 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php
997 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php
998 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php
999 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php
1000 /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php
1001 /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php
1002 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php
1003 /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php
1004 /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php
1005 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php
1006 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php
1007 /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php
1008 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php
1009 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php
1010 /vendor/doctrine/persistence/src/Persistence/ObjectManager.php
1011 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/LoggerChain.php
1012 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/SQLLogger.php
1013 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/Logger/DbalLogger.php
1014 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Logging/DebugStack.php
1015 /vendor/doctrine/doctrine-bundle/ConnectionFactory.php
1016 /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php
1017 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php
1018 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php
1019 /vendor/doctrine/event-manager/src/EventManager.php
1020 /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php
1021 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php
1022 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php
1023 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php
1024 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php
1025 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php
1026 /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php
1027 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php
1028 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php
1029 /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php
1030 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php
1031 /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php
1032 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php
1033 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php
1034 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php
1035 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php
1036 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php
1037 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php
1038 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php
1039 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php
1040 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php
1041 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php
1042 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php
1043 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php
1044 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL80Platform.php
1045 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySQL57Platform.php
1046 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php
1047 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php
1048 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php
1049 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php
1050 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php
1051 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php
1052 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php
1053 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php
1054 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php
1055 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php
1056 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php
1057 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php
1058 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php
1059 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php
1060 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php
1061 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php
1062 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php
1063 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php
1064 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php
1065 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php
1066 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php
1067 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php
1068 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php
1069 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php
1070 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php
1071 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php
1072 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php
1073 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php
1074 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php
1075 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php
1076 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php
1077 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php
1078 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php
1079 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php
1080 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php
1081 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php
1082 /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php
1083 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php
1084 /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php
1085 /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php
1086 /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php
1087 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php
1088 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php
1089 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php
1090 /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php
1091 /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php
1092 /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php
1093 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php
1094 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php
1095 /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php
1096 /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php
1097 /vendor/doctrine/persistence/src/Persistence/Proxy.php
1098 /modules/iqitproductflags/src/Entity/IqitProductFlag.php
1099 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php
1100 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php
1101 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php
1102 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php
1103 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php
1104 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php
1105 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php
1106 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php
1107 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php
1108 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php
1109 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php
1110 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php
1111 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php
1112 /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php
1113 /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php
1114 /src/PrestaShopBundle/Entity/Shop.php
1115 /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php
1116 /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php
1117 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php
1118 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php
1119 /modules/iqitproductflags/src/Repository/FlagRepository.php
1120 /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php
1121 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php
1122 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php
1123 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php
1124 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php
1125 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php
1126 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php
1127 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php
1128 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php
1129 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php
1130 /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php
1131 /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php
1132 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php
1133 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php
1134 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php
1135 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php
1136 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php
1137 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php
1138 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php
1139 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php
1140 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php
1141 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php
1142 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php
1143 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php
1144 /src/PrestaShopBundle/Entity/Lang.php
1145 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php
1146 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php
1147 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php
1148 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php
1149 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php
1150 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php
1151 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php
1152 /src/PrestaShopBundle/Entity/ShopGroup.php
1153 /src/PrestaShopBundle/Entity/ShopUrl.php
1154 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php
1155 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php
1156 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php
1157 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php
1158 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php
1159 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php
1160 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php
1161 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php
1162 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php
1163 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php
1164 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php
1165 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php
1166 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php
1167 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php
1168 /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php
1169 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php
1170 /src/PrestaShopBundle/Entity/Translation.php
1171 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php
1172 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php
1173 /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php
1174 /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php
1175 /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php
1176 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php
1177 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php
1178 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php
1179 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php
1180 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php
1181 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php
1182 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php
1183 /modules/iqitproductflags/src/Presenter/FlagPresenter.php
1184 /var/cache/dev/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php
1185 /var/cache/dev/smarty/compile/warehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1186 /vendor/smarty/smarty/libs/plugins/function.math.php
1187 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/75/b9/97/75b997bec85704ff1d7a8fb47417253a50e7be32_2.file.product-miniature-btn.tpl.php
1188 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/50/d2/88/50d288732d70e59ef94f3875a561157d73c09f9e_2.file.products-bottom.tpl.php
1189 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/ce/84/ea/ce84eadc655e6b98707bc940129b94e0b7569370_2.file.category-footer.tpl.php
1190 /modules/ps_categorytree/ps_categorytree.php
1191 /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1192 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/3a/47/3e3a47dc2c5a5d8e5e109d269aa58f1349bf3548_2.file.footer.tpl.php
1193 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e6/9f/81/e69f8156b2319dff0e9edb2994d7f3cbefe774c5_2.file.footer-2.tpl.php
1194 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/9c/7d/72/9c7d720b46cf586eae2c9cef211a724e6ca50320.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1195 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/6/warehouse/1d/83/01/1d8301bd7699d773c48e9ed487e5b638a51c9c67.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1196 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/00/82/b5/0082b5f5ed9b849deb993e6b9ea0688ca3375d26_2.file.footer-copyrights-1.tpl.php
1197 /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e7/73/6b/e7736b26e5e94f428f828dbc3573ce171a95c436_2.file.password-policy-template.tpl.php
1198 /classes/form/CustomerLoginForm.php
1199 /classes/form/AbstractForm.php
1200 /classes/form/FormInterface.php
1201 /src/Core/Foundation/Templating/RenderableInterface.php
1202 /classes/form/CustomerLoginFormatter.php
1203 /classes/form/FormFormatterInterface.php
1204 /classes/ValidateConstraintTranslator.php
1205 /src/Core/Util/InternationalizedDomainNameConverter.php
1206 /src/Core/Foundation/Templating/RenderableProxy.php
1207 /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1208 /classes/form/FormField.php
1209 /var/cache/dev/smarty/compile/warehouse/f2/1e/55/f21e55894ac1dca3333e5ff490219e193d3a69c6_2.file.login-form.tpl.php
1210 /var/cache/dev/smarty/compile/warehouse/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1211 /var/cache/dev/smarty/compile/d2/95/88/d29588162f18c1514f5b17d42ceef7eee6820be1_2.file.form-fields.tpl.php
1212 /var/cache/dev/smarty/compile/b6/4f/94/b64f94792cdb12fa46df54c870644b43e33883dc_2.file.form-errors.tpl.php
1213 /var/cache/dev/smarty/cache/iqitsociallogin/1/1/1/6/warehouse/60/1e/f4/601ef4a2f7dca2c97f8f1a899dc64be4a2331ab8.iqitsocialloginviewstemplateshookauthentication.tpl.php
1214 /var/cache/dev/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1215 /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/02/05/98/020598f14f8b3a756a608f01492a41ebd60e5afd.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1216 /modules/statsdata/statsdata.php
1217 /classes/Connection.php
1218 /classes/ConnectionsSource.php
1219 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1220 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1221 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1222 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1223 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1224 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1225 /var/cache/dev/smarty/compile/warehouse/0b/04/d5/0b04d5d296cc40e94fc50a82355434090632a0d7_2.file.ga_tag.tpl.php